BLASTX nr result
ID: Zanthoxylum22_contig00021641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021641 (269 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO77866.1| hypothetical protein CISIN_1g043774mg [Citrus sin... 59 7e-10 ref|XP_006467643.1| PREDICTED: cysteine proteinase RD21a-like [C... 59 7e-10 ref|XP_006449509.1| hypothetical protein CICLE_v10015066mg [Citr... 59 7e-10 ref|XP_010999738.1| PREDICTED: low-temperature-induced cysteine ... 58 2e-07 ref|XP_002305743.2| hypothetical protein POPTR_0004s05640g [Popu... 58 2e-07 ref|XP_010052188.1| PREDICTED: low-temperature-induced cysteine ... 59 4e-07 gb|KCW76106.1| hypothetical protein EUGRSUZ_D00484 [Eucalyptus g... 59 4e-07 ref|XP_007025363.1| Xylem bark cysteine peptidase 3 isoform 1 [T... 60 4e-07 ref|XP_012449992.1| PREDICTED: low-temperature-induced cysteine ... 59 4e-07 gb|KJB66815.1| hypothetical protein B456_010G159600 [Gossypium r... 59 4e-07 gb|KJB66817.1| hypothetical protein B456_010G159600 [Gossypium r... 59 4e-07 gb|KJB66816.1| hypothetical protein B456_010G159600 [Gossypium r... 59 4e-07 gb|AAO18731.1| cysteine protease [Gossypium hirsutum] 59 4e-07 ref|XP_007025364.1| Xylem bark cysteine peptidase 3 isoform 2 [T... 60 4e-07 gb|KJB66820.1| hypothetical protein B456_010G159600 [Gossypium r... 59 4e-07 ref|XP_004293953.1| PREDICTED: low-temperature-induced cysteine ... 56 6e-07 ref|XP_007148042.1| hypothetical protein PHAVU_006G175500g [Phas... 56 7e-07 ref|XP_002317418.2| hypothetical protein POPTR_0011s07310g [Popu... 56 7e-07 ref|XP_011039436.1| PREDICTED: low-temperature-induced cysteine ... 56 7e-07 ref|XP_004485897.1| PREDICTED: low-temperature-induced cysteine ... 56 7e-07 >gb|KDO77866.1| hypothetical protein CISIN_1g043774mg [Citrus sinensis] Length = 485 Score = 59.3 bits (142), Expect(2) = 7e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WGIDGY Sbjct: 290 DHAVLIVGYGSENGEDYWIVKNSWGTSWGIDGY 322 Score = 30.8 bits (68), Expect(2) = 7e-10 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 144 GIYDGDCYNSPYYI 103 GIY+GDC N PYYI Sbjct: 276 GIYNGDCSNDPYYI 289 >ref|XP_006467643.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis] Length = 485 Score = 59.3 bits (142), Expect(2) = 7e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WGIDGY Sbjct: 290 DHAVLIVGYGSENGEDYWIVKNSWGTSWGIDGY 322 Score = 30.8 bits (68), Expect(2) = 7e-10 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 144 GIYDGDCYNSPYYI 103 GIY+GDC N PYYI Sbjct: 276 GIYNGDCSNDPYYI 289 >ref|XP_006449509.1| hypothetical protein CICLE_v10015066mg [Citrus clementina] gi|557552120|gb|ESR62749.1| hypothetical protein CICLE_v10015066mg [Citrus clementina] Length = 485 Score = 59.3 bits (142), Expect(2) = 7e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WGIDGY Sbjct: 290 DHAVLIVGYGSENGEDYWIVKNSWGTSWGIDGY 322 Score = 30.8 bits (68), Expect(2) = 7e-10 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 144 GIYDGDCYNSPYYI 103 GIY+GDC N PYYI Sbjct: 276 GIYNGDCSNDPYYI 289 >ref|XP_010999738.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus euphratica] Length = 508 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WGI+GY Sbjct: 305 DHAVLIVGYGSENGEDYWIVKNSWGTSWGIEGY 337 Score = 23.9 bits (50), Expect(2) = 2e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDGDC + P Sbjct: 291 GIYDGDCSDDP 301 >ref|XP_002305743.2| hypothetical protein POPTR_0004s05640g [Populus trichocarpa] gi|550340399|gb|EEE86254.2| hypothetical protein POPTR_0004s05640g [Populus trichocarpa] Length = 506 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WGI+GY Sbjct: 305 DHAVLIVGYGSENGEDYWIVKNSWGTSWGIEGY 337 Score = 23.9 bits (50), Expect(2) = 2e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDGDC + P Sbjct: 291 GIYDGDCSDDP 301 >ref|XP_010052188.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Eucalyptus grandis] Length = 521 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WGIDGY Sbjct: 314 DHAVLIVGYGSENGEDYWIVKNSWGTDWGIDGY 346 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 300 GIYDGSCSSDP 310 >gb|KCW76106.1| hypothetical protein EUGRSUZ_D00484 [Eucalyptus grandis] Length = 512 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WGIDGY Sbjct: 305 DHAVLIVGYGSENGEDYWIVKNSWGTDWGIDGY 337 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 291 GIYDGSCSSDP 301 >ref|XP_007025363.1| Xylem bark cysteine peptidase 3 isoform 1 [Theobroma cacao] gi|508780729|gb|EOY27985.1| Xylem bark cysteine peptidase 3 isoform 1 [Theobroma cacao] Length = 501 Score = 60.1 bits (144), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+DGE YWI K+S GT WG+DGY Sbjct: 300 DHAVLIVGYGSEDGEDYWIVKNSWGTSWGMDGY 332 Score = 20.4 bits (41), Expect(2) = 4e-07 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GI+DG C ++P Sbjct: 286 GIFDGSCSDNP 296 >ref|XP_012449992.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Gossypium raimondii] gi|763799863|gb|KJB66818.1| hypothetical protein B456_010G159600 [Gossypium raimondii] gi|763799864|gb|KJB66819.1| hypothetical protein B456_010G159600 [Gossypium raimondii] Length = 497 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+D E YWI K+S GT WGIDGY Sbjct: 300 DHAVLIVGYGSEDSEEYWIVKNSWGTSWGIDGY 332 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 286 GIYDGSCSDDP 296 >gb|KJB66815.1| hypothetical protein B456_010G159600 [Gossypium raimondii] Length = 496 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+D E YWI K+S GT WGIDGY Sbjct: 299 DHAVLIVGYGSEDSEEYWIVKNSWGTSWGIDGY 331 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 285 GIYDGSCSDDP 295 >gb|KJB66817.1| hypothetical protein B456_010G159600 [Gossypium raimondii] Length = 484 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+D E YWI K+S GT WGIDGY Sbjct: 287 DHAVLIVGYGSEDSEEYWIVKNSWGTSWGIDGY 319 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 273 GIYDGSCSDDP 283 >gb|KJB66816.1| hypothetical protein B456_010G159600 [Gossypium raimondii] Length = 457 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+D E YWI K+S GT WGIDGY Sbjct: 300 DHAVLIVGYGSEDSEEYWIVKNSWGTSWGIDGY 332 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 286 GIYDGSCSDDP 296 >gb|AAO18731.1| cysteine protease [Gossypium hirsutum] Length = 389 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+D E YWI K+S GT WGIDGY Sbjct: 300 DHAVLIVGYGSEDSEEYWIVKNSWGTSWGIDGY 332 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 286 GIYDGSCSDDP 296 >ref|XP_007025364.1| Xylem bark cysteine peptidase 3 isoform 2 [Theobroma cacao] gi|508780730|gb|EOY27986.1| Xylem bark cysteine peptidase 3 isoform 2 [Theobroma cacao] Length = 343 Score = 60.1 bits (144), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+DGE YWI K+S GT WG+DGY Sbjct: 142 DHAVLIVGYGSEDGEDYWIVKNSWGTSWGMDGY 174 Score = 20.4 bits (41), Expect(2) = 4e-07 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GI+DG C ++P Sbjct: 128 GIFDGSCSDNP 138 >gb|KJB66820.1| hypothetical protein B456_010G159600 [Gossypium raimondii] Length = 339 Score = 58.9 bits (141), Expect(2) = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+D E YWI K+S GT WGIDGY Sbjct: 142 DHAVLIVGYGSEDSEEYWIVKNSWGTSWGIDGY 174 Score = 21.6 bits (44), Expect(2) = 4e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDG C + P Sbjct: 128 GIYDGSCSDDP 138 >ref|XP_004293953.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Fragaria vesca subsp. vesca] Length = 519 Score = 56.2 bits (134), Expect(2) = 6e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+ GE YWI K+S GT WG++GY Sbjct: 310 DHAVLIVGYGSESGEDYWIVKNSWGTSWGMEGY 342 Score = 23.9 bits (50), Expect(2) = 6e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDGDC + P Sbjct: 296 GIYDGDCSDDP 306 >ref|XP_007148042.1| hypothetical protein PHAVU_006G175500g [Phaseolus vulgaris] gi|561021265|gb|ESW20036.1| hypothetical protein PHAVU_006G175500g [Phaseolus vulgaris] Length = 507 Score = 55.8 bits (133), Expect(2) = 7e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S+D E YWI K+S GT WG++GY Sbjct: 310 DHAVLIVGYGSEDDEDYWIVKNSWGTSWGMEGY 342 Score = 23.9 bits (50), Expect(2) = 7e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDGDC + P Sbjct: 296 GIYDGDCSSDP 306 >ref|XP_002317418.2| hypothetical protein POPTR_0011s07310g [Populus trichocarpa] gi|550327862|gb|EEE98030.2| hypothetical protein POPTR_0011s07310g [Populus trichocarpa] Length = 503 Score = 55.8 bits (133), Expect(2) = 7e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WG++GY Sbjct: 301 DHAVLIVGYGSENGEDYWIVKNSWGTEWGMEGY 333 Score = 23.9 bits (50), Expect(2) = 7e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDGDC + P Sbjct: 287 GIYDGDCSDDP 297 >ref|XP_011039436.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Populus euphratica] Length = 499 Score = 55.8 bits (133), Expect(2) = 7e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY S++GE YWI K+S GT WG++GY Sbjct: 300 DHAVLIVGYGSENGEDYWIVKNSWGTEWGMEGY 332 Score = 23.9 bits (50), Expect(2) = 7e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDGDC + P Sbjct: 286 GIYDGDCSDDP 296 >ref|XP_004485897.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cicer arietinum] Length = 492 Score = 55.8 bits (133), Expect(2) = 7e-07 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 101 DHAVLIVGYDSKDGESYWIAKSS*GTGWGIDGY 3 DHAVLIVGY SK E YWI K+S GT WGI+GY Sbjct: 295 DHAVLIVGYGSKGDEDYWIVKNSWGTNWGIEGY 327 Score = 23.9 bits (50), Expect(2) = 7e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 144 GIYDGDCYNSP 112 GIYDGDC + P Sbjct: 281 GIYDGDCSSDP 291