BLASTX nr result
ID: Zanthoxylum22_contig00021549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021549 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012068458.1| PREDICTED: uncharacterized protein LOC105631... 56 9e-06 ref|XP_012065816.1| PREDICTED: uncharacterized protein LOC105628... 56 9e-06 >ref|XP_012068458.1| PREDICTED: uncharacterized protein LOC105631070 [Jatropha curcas] Length = 313 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 156 AATIGKLLRVDNATATANRPSVARILIEHGISKPLLHRLWIGEGNSGFLQGI 1 A IGK L+VD ATAT +RPSVAR+ +E +SK L +++WI +G+ GF Q + Sbjct: 42 ANLIGKPLKVDAATATLSRPSVARVCVELDLSKDLPNKVWIDDGDLGFFQPV 93 >ref|XP_012065816.1| PREDICTED: uncharacterized protein LOC105628933 [Jatropha curcas] Length = 397 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 156 AATIGKLLRVDNATATANRPSVARILIEHGISKPLLHRLWIGEGNSGFLQGI 1 A IGK L+VD ATAT +RPSVAR+ +E +SK L +++WI +G+ GF Q + Sbjct: 184 ANLIGKPLKVDAATATLSRPSVARVCVELDLSKDLPNKVWIDDGDLGFFQPV 235