BLASTX nr result
ID: Zanthoxylum22_contig00021539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021539 (653 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO59422.1| hypothetical protein CISIN_1g000758mg [Citrus sin... 88 5e-15 gb|KDO59421.1| hypothetical protein CISIN_1g000758mg [Citrus sin... 88 5e-15 gb|KDO59420.1| hypothetical protein CISIN_1g000758mg [Citrus sin... 88 5e-15 ref|XP_006473981.1| PREDICTED: microtubule-associated protein fu... 88 5e-15 ref|XP_006473979.1| PREDICTED: microtubule-associated protein fu... 88 5e-15 ref|XP_006453657.1| hypothetical protein CICLE_v10007258mg [Citr... 86 2e-14 ref|XP_008443875.1| PREDICTED: trichohyalin isoform X1 [Cucumis ... 84 7e-14 ref|XP_004146694.1| PREDICTED: FIP1[V]-like protein isoform X1 [... 84 7e-14 ref|XP_007011969.1| FIP1, putative isoform 2 [Theobroma cacao] g... 83 1e-13 ref|XP_007011968.1| FIP1, putative isoform 1 [Theobroma cacao] g... 83 1e-13 ref|XP_014495795.1| PREDICTED: FIP1[V]-like protein [Vigna radia... 83 2e-13 ref|XP_010656604.1| PREDICTED: FIP1[V]-like protein [Vitis vinif... 82 3e-13 ref|XP_012441988.1| PREDICTED: FIP1[V]-like protein isoform X2 [... 81 5e-13 gb|KJB07588.1| hypothetical protein B456_001G031400 [Gossypium r... 81 5e-13 ref|XP_012441959.1| PREDICTED: FIP1[V]-like protein isoform X1 [... 81 5e-13 gb|KOM40226.1| hypothetical protein LR48_Vigan04g042400 [Vigna a... 81 6e-13 ref|XP_004513530.1| PREDICTED: FIP1[V]-like protein [Cicer ariet... 80 8e-13 gb|KHN35290.1| Pre-mRNA 3'-end-processing factor FIP1 [Glycine s... 80 1e-12 ref|XP_006587147.1| PREDICTED: uncharacterized protein LOC100803... 80 1e-12 ref|XP_003535062.1| PREDICTED: uncharacterized protein LOC100803... 80 1e-12 >gb|KDO59422.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis] Length = 1258 Score = 87.8 bits (216), Expect = 5e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKDTLAIKK+ESEPLP TKSET A SEIKQERPARKRRWI + Sbjct: 1209 RFKLPMPSEKDTLAIKKMESEPLPSTKSETAAGSEIKQERPARKRRWISN 1258 >gb|KDO59421.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis] Length = 1295 Score = 87.8 bits (216), Expect = 5e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKDTLAIKK+ESEPLP TKSET A SEIKQERPARKRRWI + Sbjct: 1246 RFKLPMPSEKDTLAIKKMESEPLPSTKSETAAGSEIKQERPARKRRWISN 1295 >gb|KDO59420.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis] Length = 1299 Score = 87.8 bits (216), Expect = 5e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKDTLAIKK+ESEPLP TKSET A SEIKQERPARKRRWI + Sbjct: 1250 RFKLPMPSEKDTLAIKKMESEPLPSTKSETAAGSEIKQERPARKRRWISN 1299 >ref|XP_006473981.1| PREDICTED: microtubule-associated protein futsch-like isoform X3 [Citrus sinensis] Length = 1342 Score = 87.8 bits (216), Expect = 5e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKDTLAIKK+ESEPLP TKSET A SEIKQERPARKRRWI + Sbjct: 1293 RFKLPMPSEKDTLAIKKMESEPLPSTKSETAAGSEIKQERPARKRRWISN 1342 >ref|XP_006473979.1| PREDICTED: microtubule-associated protein futsch-like isoform X1 [Citrus sinensis] gi|568840042|ref|XP_006473980.1| PREDICTED: microtubule-associated protein futsch-like isoform X2 [Citrus sinensis] Length = 1346 Score = 87.8 bits (216), Expect = 5e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKDTLAIKK+ESEPLP TKSET A SEIKQERPARKRRWI + Sbjct: 1297 RFKLPMPSEKDTLAIKKMESEPLPSTKSETAAGSEIKQERPARKRRWISN 1346 >ref|XP_006453657.1| hypothetical protein CICLE_v10007258mg [Citrus clementina] gi|557556883|gb|ESR66897.1| hypothetical protein CICLE_v10007258mg [Citrus clementina] Length = 1346 Score = 85.9 bits (211), Expect = 2e-14 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKDTLAIKK+E EPLP TKSET A SEIKQERPARKRRWI + Sbjct: 1297 RFKLPMPSEKDTLAIKKMEREPLPSTKSETAAGSEIKQERPARKRRWISN 1346 >ref|XP_008443875.1| PREDICTED: trichohyalin isoform X1 [Cucumis melo] Length = 1397 Score = 84.0 bits (206), Expect = 7e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EK+ L IKK+ESEPLP +KSE PADSEIK ERPARKRRWI S Sbjct: 1347 RFKLPMPSEKEALVIKKMESEPLPSSKSEAPADSEIKPERPARKRRWISS 1396 >ref|XP_004146694.1| PREDICTED: FIP1[V]-like protein isoform X1 [Cucumis sativus] Length = 1399 Score = 84.0 bits (206), Expect = 7e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EK+ L IKK+ESEPLP +KSE PADSEIK ERPARKRRWI S Sbjct: 1349 RFKLPMPSEKEALVIKKMESEPLPSSKSEAPADSEIKPERPARKRRWISS 1398 >ref|XP_007011969.1| FIP1, putative isoform 2 [Theobroma cacao] gi|508782332|gb|EOY29588.1| FIP1, putative isoform 2 [Theobroma cacao] Length = 1063 Score = 83.2 bits (204), Expect = 1e-13 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKD LAIKK+ESE LP K+ETPADSEIK ERPARKRRWI + Sbjct: 1014 RFKLPMPSEKDALAIKKMESEALPSAKNETPADSEIKPERPARKRRWISN 1063 >ref|XP_007011968.1| FIP1, putative isoform 1 [Theobroma cacao] gi|508782331|gb|EOY29587.1| FIP1, putative isoform 1 [Theobroma cacao] Length = 1356 Score = 83.2 bits (204), Expect = 1e-13 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EKD LAIKK+ESE LP K+ETPADSEIK ERPARKRRWI + Sbjct: 1307 RFKLPMPSEKDALAIKKMESEALPSAKNETPADSEIKPERPARKRRWISN 1356 >ref|XP_014495795.1| PREDICTED: FIP1[V]-like protein [Vigna radiata var. radiata] Length = 1321 Score = 82.8 bits (203), Expect = 2e-13 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWI 508 RFKLP+P EK+ L IKKLESEPLP KSE P DSE+KQERPARKRRW+ Sbjct: 1272 RFKLPMPSEKEALVIKKLESEPLPSAKSENPVDSEVKQERPARKRRWV 1319 >ref|XP_010656604.1| PREDICTED: FIP1[V]-like protein [Vitis vinifera] Length = 1474 Score = 82.0 bits (201), Expect = 3e-13 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RFKLP+P EK+ +A+KK+ SE LPP +ETPADSEIKQERPARKRRW+G+ Sbjct: 1425 RFKLPMPSEKEAVAVKKVGSEALPPAPTETPADSEIKQERPARKRRWVGN 1474 >ref|XP_012441988.1| PREDICTED: FIP1[V]-like protein isoform X2 [Gossypium raimondii] Length = 1264 Score = 81.3 bits (199), Expect = 5e-13 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWI 508 RFKLP+P EKD +AIKK+ESE LP K+ETPADSE+K ERPARKRRWI Sbjct: 1215 RFKLPMPKEKDAMAIKKMESEALPSAKNETPADSEVKPERPARKRRWI 1262 >gb|KJB07588.1| hypothetical protein B456_001G031400 [Gossypium raimondii] Length = 932 Score = 81.3 bits (199), Expect = 5e-13 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWI 508 RFKLP+P EKD +AIKK+ESE LP K+ETPADSE+K ERPARKRRWI Sbjct: 883 RFKLPMPKEKDAMAIKKMESEALPSAKNETPADSEVKPERPARKRRWI 930 >ref|XP_012441959.1| PREDICTED: FIP1[V]-like protein isoform X1 [Gossypium raimondii] gi|763740088|gb|KJB07587.1| hypothetical protein B456_001G031400 [Gossypium raimondii] Length = 1339 Score = 81.3 bits (199), Expect = 5e-13 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWI 508 RFKLP+P EKD +AIKK+ESE LP K+ETPADSE+K ERPARKRRWI Sbjct: 1290 RFKLPMPKEKDAMAIKKMESEALPSAKNETPADSEVKPERPARKRRWI 1337 >gb|KOM40226.1| hypothetical protein LR48_Vigan04g042400 [Vigna angularis] Length = 727 Score = 80.9 bits (198), Expect = 6e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWI 508 RFKLP+P EK+ + IKKLESEPLP K+E P DSE+KQERPARKRRW+ Sbjct: 678 RFKLPMPSEKEAIVIKKLESEPLPSAKTENPVDSEVKQERPARKRRWV 725 >ref|XP_004513530.1| PREDICTED: FIP1[V]-like protein [Cicer arietinum] Length = 1335 Score = 80.5 bits (197), Expect = 8e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETPADSEIKQERPARKRRWIGS 502 RF+LP+P EK+ L IKKLESEPLP KSE P +SE+KQERPARKRRWI + Sbjct: 1286 RFQLPMPSEKEALVIKKLESEPLPSVKSENPVESEVKQERPARKRRWISN 1335 >gb|KHN35290.1| Pre-mRNA 3'-end-processing factor FIP1 [Glycine soja] Length = 1125 Score = 80.1 bits (196), Expect = 1e-12 Identities = 38/49 (77%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETP-ADSEIKQERPARKRRWI 508 RFKLP+P EK+TL IKKLESEPLP KSE P DSE+KQERPARKRRW+ Sbjct: 1075 RFKLPMPSEKETLVIKKLESEPLPSAKSENPVVDSEVKQERPARKRRWV 1123 >ref|XP_006587147.1| PREDICTED: uncharacterized protein LOC100803769 isoform X2 [Glycine max] gi|947089240|gb|KRH37905.1| hypothetical protein GLYMA_09G097600 [Glycine max] Length = 1318 Score = 80.1 bits (196), Expect = 1e-12 Identities = 38/49 (77%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETP-ADSEIKQERPARKRRWI 508 RFKLP+P EK+TL IKKLESEPLP KSE P DSE+KQERPARKRRW+ Sbjct: 1268 RFKLPMPSEKETLVIKKLESEPLPSAKSENPVVDSEVKQERPARKRRWV 1316 >ref|XP_003535062.1| PREDICTED: uncharacterized protein LOC100803769 isoform X1 [Glycine max] gi|947089239|gb|KRH37904.1| hypothetical protein GLYMA_09G097600 [Glycine max] Length = 1316 Score = 80.1 bits (196), Expect = 1e-12 Identities = 38/49 (77%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -3 Query: 651 RFKLPLPIEKDTLAIKKLESEPLPPTKSETP-ADSEIKQERPARKRRWI 508 RFKLP+P EK+TL IKKLESEPLP KSE P DSE+KQERPARKRRW+ Sbjct: 1266 RFKLPMPSEKETLVIKKLESEPLPSAKSENPVVDSEVKQERPARKRRWV 1314