BLASTX nr result
ID: Zanthoxylum22_contig00021304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021304 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476539.1| PREDICTED: puromycin-sensitive aminopeptidas... 61 3e-07 >ref|XP_006476539.1| PREDICTED: puromycin-sensitive aminopeptidase-like isoform X1 [Citrus sinensis] Length = 981 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 100 MARLILPCKSSCLTRATILGFISSSPRQATGRV 2 MARLILPCK+SCLT+ +LGFISSSPRQATGRV Sbjct: 1 MARLILPCKNSCLTKTALLGFISSSPRQATGRV 33