BLASTX nr result
ID: Zanthoxylum22_contig00021169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021169 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006423944.1| hypothetical protein CICLE_v10029557mg [Citr... 70 6e-10 >ref|XP_006423944.1| hypothetical protein CICLE_v10029557mg [Citrus clementina] gi|557525878|gb|ESR37184.1| hypothetical protein CICLE_v10029557mg [Citrus clementina] gi|641837407|gb|KDO56361.1| hypothetical protein CISIN_1g039103mg [Citrus sinensis] Length = 135 Score = 70.1 bits (170), Expect = 6e-10 Identities = 39/69 (56%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = +3 Query: 183 MSDSIKEISKLDDDQEAGDG---GFWSFRNAKKVLLFPIAKAKKRFFH-RRNKQQEEQNK 350 MS++IKEIS+LDDD A G SFR AKKV+LFP A AKK+FFH RR KQQ+++NK Sbjct: 1 MSEAIKEISELDDDGRAAGGVRVKQRSFRKAKKVVLFPFATAKKQFFHNRRKKQQQQENK 60 Query: 351 RISSPAAAA 377 +S ++ A Sbjct: 61 TVSFASSVA 69