BLASTX nr result
ID: Zanthoxylum22_contig00019867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00019867 (295 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO73134.1| hypothetical protein CISIN_1g001014mg [Citrus sin... 69 1e-09 ref|XP_006424649.1| hypothetical protein CICLE_v10027703mg [Citr... 69 1e-09 >gb|KDO73134.1| hypothetical protein CISIN_1g001014mg [Citrus sinensis] Length = 1190 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -1 Query: 295 AIRSLKSNTVTMTALQDFFDVETTSGSSENLQSASTSI 182 AIRSLKSNTVTMTALQDFFDVET SGSSENLQS STS+ Sbjct: 1153 AIRSLKSNTVTMTALQDFFDVETASGSSENLQSVSTSL 1190 >ref|XP_006424649.1| hypothetical protein CICLE_v10027703mg [Citrus clementina] gi|568869938|ref|XP_006488171.1| PREDICTED: carbamoyl-phosphate synthase large chain, chloroplastic-like [Citrus sinensis] gi|557526583|gb|ESR37889.1| hypothetical protein CICLE_v10027703mg [Citrus clementina] Length = 1190 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -1 Query: 295 AIRSLKSNTVTMTALQDFFDVETTSGSSENLQSASTSI 182 AIRSLKSNTVTMTALQDFFDVET SGSSENLQS STS+ Sbjct: 1153 AIRSLKSNTVTMTALQDFFDVETASGSSENLQSVSTSL 1190