BLASTX nr result
ID: Zanthoxylum22_contig00019717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00019717 (349 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006449054.1| hypothetical protein CICLE_v10015479mg [Citr... 77 5e-12 gb|KDO75487.1| hypothetical protein CISIN_1g041936mg, partial [C... 76 1e-11 ref|XP_006468012.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_010101448.1| hypothetical protein L484_012870 [Morus nota... 68 2e-09 ref|XP_011037679.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_002305587.1| pentatricopeptide repeat-containing family p... 65 2e-08 ref|XP_006449053.1| hypothetical protein CICLE_v10015461mg [Citr... 65 2e-08 ref|XP_010476095.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_011048015.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_006307697.1| hypothetical protein CARUB_v10009327mg [Caps... 64 4e-08 ref|XP_010493065.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_006389650.1| pentatricopeptide repeat-containing family p... 64 6e-08 ref|XP_011652746.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_010473407.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|NP_564786.1| pentatricopeptide repeat-containing protein [Ar... 63 7e-08 gb|AAM62848.1| putative membrane-associated salt-inducible prote... 63 7e-08 ref|XP_010430213.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|NP_172629.1| pentatricopeptide repeat-containing protein [Ar... 63 1e-07 ref|XP_002886503.1| pentatricopeptide repeat-containing protein ... 63 1e-07 ref|XP_012455712.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 >ref|XP_006449054.1| hypothetical protein CICLE_v10015479mg [Citrus clementina] gi|557551665|gb|ESR62294.1| hypothetical protein CICLE_v10015479mg [Citrus clementina] Length = 402 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FSTMKSL+TGLA AS V+ AKELIGLVK KFTKNVD W+EIEAGLP Sbjct: 356 FSTMKSLVTGLAGASKVSEAKELIGLVKEKFTKNVDTWNEIEAGLP 401 >gb|KDO75487.1| hypothetical protein CISIN_1g041936mg, partial [Citrus sinensis] Length = 402 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 F+TMKSL+TGLA AS V+ AKELIGLVK KFTKNVD W+EIEAGLP Sbjct: 356 FTTMKSLVTGLAGASKVSEAKELIGLVKEKFTKNVDTWNEIEAGLP 401 >ref|XP_006468012.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Citrus sinensis] Length = 402 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 F+TMKSL+TGLA S V+ AKELIGLVK KFTKNVD W EIEAGLP Sbjct: 356 FTTMKSLVTGLAGVSKVSEAKELIGLVKEKFTKNVDTWKEIEAGLP 401 >ref|XP_010101448.1| hypothetical protein L484_012870 [Morus notabilis] gi|587900084|gb|EXB88431.1| hypothetical protein L484_012870 [Morus notabilis] Length = 394 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FSTMKSL+ GL SAS V A+ELI VK KFT NVDMW+EIEAGLP Sbjct: 348 FSTMKSLVEGLVSASRVTEARELISQVKEKFTVNVDMWNEIEAGLP 393 >ref|XP_011037679.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Populus euphratica] Length = 404 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -2 Query: 345 STMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 STMK L+ GLAS+ NV AKELIG +K KF+KNV++W+E+EAGLP Sbjct: 359 STMKMLVEGLASSGNVEKAKELIGEIKEKFSKNVELWNEVEAGLP 403 >ref|XP_002305587.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222848551|gb|EEE86098.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 359 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -2 Query: 345 STMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 STMK L+ GLAS+ NV AKELIG +K KF+KNV++W+E+EAGLP Sbjct: 314 STMKMLVEGLASSGNVEKAKELIGEIKEKFSKNVELWNEVEAGLP 358 >ref|XP_006449053.1| hypothetical protein CICLE_v10015461mg [Citrus clementina] gi|557551664|gb|ESR62293.1| hypothetical protein CICLE_v10015461mg [Citrus clementina] Length = 404 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FSTMKSL+TGLAS S VA A ELIGL+K +F K+ DMW++IEA LP Sbjct: 357 FSTMKSLVTGLASISKVAEANELIGLMKKRFPKSGDMWNDIEAALP 402 >ref|XP_010476095.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11630, mitochondrial-like [Camelina sativa] Length = 404 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MK L+ GLAS S V+ AKELI LVK KFT+NVD+W E+EA LP Sbjct: 358 FSIMKWLVNGLASVSKVSEAKELIALVKEKFTRNVDLWKEVEAALP 403 >ref|XP_011048015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Populus euphratica] Length = 461 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FSTMK L+ GLAS+ V AKELIG VK +F+KN+++W+EIEAGLP Sbjct: 415 FSTMKILVQGLASSGEVDKAKELIGEVKERFSKNIELWNEIEAGLP 460 >ref|XP_006307697.1| hypothetical protein CARUB_v10009327mg [Capsella rubella] gi|482576408|gb|EOA40595.1| hypothetical protein CARUB_v10009327mg [Capsella rubella] Length = 403 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MK L+ GLAS S V AKELI LVK KFT+NVD+W E+EA LP Sbjct: 357 FSVMKWLVNGLASLSKVGEAKELIALVKRKFTRNVDLWKEVEAALP 402 >ref|XP_010493065.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11630, mitochondrial-like [Camelina sativa] Length = 402 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MK L+ GLAS S V+ AKELI LVK KFT+NVD+W E+EA LP Sbjct: 356 FSVMKWLVNGLASRSKVSEAKELIELVKEKFTRNVDLWKEVEAALP 401 >ref|XP_006389650.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550312479|gb|ERP48564.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 401 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FSTMK L+ GLAS+ V AKELIG VK +F+KN+++W+E+EAGLP Sbjct: 355 FSTMKILVQGLASSGEVDKAKELIGEVKERFSKNIELWNEVEAGLP 400 >ref|XP_011652746.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Cucumis sativus] gi|700209439|gb|KGN64535.1| hypothetical protein Csa_1G063590 [Cucumis sativus] Length = 405 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FSTMKSL+ GL S S V AK+LIG +K +F+KNV+ W EIEAGLP Sbjct: 359 FSTMKSLVDGLVSISKVEEAKQLIGQIKERFSKNVEKWSEIEAGLP 404 >ref|XP_010473407.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Camelina sativa] Length = 414 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MKSL+ GLA S V AKELIG VK KFT+NV++W+E+EA LP Sbjct: 368 FSIMKSLVNGLAKDSKVEEAKELIGQVKEKFTRNVELWNEVEAALP 413 >ref|NP_564786.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806489|sp|Q8LE47.2|PPR87_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g61870, mitochondrial; AltName: Full=Protein PENTATRICOPEPTIDE REPEAT 336; Flags: Precursor gi|16226403|gb|AAL16159.1|AF428391_1 At1g61870/F8K4_8 [Arabidopsis thaliana] gi|3367521|gb|AAC28506.1| Similar to gb|U08285 membrane-associated salt-inducible protein from Nicotiana tabacum. ESTs gb|T44131 and gb|T04378 come from this gene [Arabidopsis thaliana] gi|17065564|gb|AAL32936.1| Unknown protein [Arabidopsis thaliana] gi|32815835|gb|AAP88326.1| At1g61870 [Arabidopsis thaliana] gi|332195777|gb|AEE33898.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 408 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MKSL+ GLA S V AKELIG VK KFT+NV++W+E+EA LP Sbjct: 362 FSIMKSLVNGLAKDSKVEEAKELIGQVKEKFTRNVELWNEVEAALP 407 >gb|AAM62848.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] Length = 407 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MKSL+ GLA S V AKELIG VK KFT+NV++W+E+EA LP Sbjct: 361 FSIMKSLVNGLAKDSKVEEAKELIGQVKEKFTRNVELWNEVEAALP 406 >ref|XP_010430213.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Camelina sativa] Length = 411 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MKSL+ GLA S V AKELIG VK KFT+NV++W+E+EA LP Sbjct: 365 FSIMKSLVNGLAKDSKVDEAKELIGQVKEKFTRNVELWNEVEAALP 410 >ref|NP_172629.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200551|sp|Q9SAB4.1|PPR33_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g11630, mitochondrial; Flags: Precursor gi|4835794|gb|AAD30260.1|AC007296_21 Strong similarity to gi|3367521 F8K4.8 from Arabidopsis thaliana BAC gb|AC004392 [Arabidopsis thaliana] gi|14326576|gb|AAK60332.1|AF385742_1 At1g11630/F25C20_22 [Arabidopsis thaliana] gi|19548051|gb|AAL87389.1| At1g11630/F25C20_22 [Arabidopsis thaliana] gi|21593339|gb|AAM65288.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] gi|332190642|gb|AEE28763.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 405 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MK L+ GLAS S V AKELI +VK KFT+NVD+W+E+EA LP Sbjct: 357 FSVMKWLVNGLASRSKVDEAKELIAVVKEKFTRNVDLWNEVEAALP 402 >ref|XP_002886503.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297332344|gb|EFH62762.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGLP 211 FS MKSL+ GLA S V AKELIG VK KFT+NV++W+E+EA LP Sbjct: 362 FSIMKSLVNGLAKDSKVDEAKELIGQVKEKFTRNVELWNEVEAALP 407 >ref|XP_012455712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium raimondii] gi|763802373|gb|KJB69311.1| hypothetical protein B456_011G015700 [Gossypium raimondii] Length = 396 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -2 Query: 348 FSTMKSLITGLASASNVAGAKELIGLVKGKFTKNVDMWDEIEAGL 214 FSTMKSL+ GL S S V AKELI VK KF+KN D+WDEIE GL Sbjct: 351 FSTMKSLVNGLVSISKVEEAKELIKNVKKKFSKNADLWDEIEKGL 395