BLASTX nr result
ID: Zanthoxylum22_contig00019308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00019308 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430085.1| hypothetical protein CICLE_v10011613mg [Citr... 83 7e-14 gb|KDO36647.1| hypothetical protein CISIN_1g011566mg [Citrus sin... 80 8e-13 ref|XP_006481575.1| PREDICTED: aspartic proteinase nepenthesin-1... 80 8e-13 ref|XP_012468131.1| PREDICTED: aspartic proteinase nepenthesin-2... 65 2e-08 ref|XP_012485755.1| PREDICTED: aspartic proteinase nepenthesin-2... 64 6e-08 ref|XP_012074343.1| PREDICTED: aspartic proteinase nepenthesin-1... 64 6e-08 ref|XP_007027933.1| Eukaryotic aspartyl protease family protein,... 63 8e-08 ref|XP_006291053.1| hypothetical protein CARUB_v10017168mg [Caps... 63 8e-08 ref|XP_014495153.1| PREDICTED: aspartic proteinase nepenthesin-2... 63 1e-07 gb|KOM39095.1| hypothetical protein LR48_Vigan03g247700 [Vigna a... 63 1e-07 ref|XP_002877867.1| aspartyl protease family protein [Arabidopsi... 63 1e-07 ref|XP_011044027.1| PREDICTED: aspartic proteinase nepenthesin-1... 62 1e-07 ref|XP_010515715.1| PREDICTED: aspartic proteinase nepenthesin-2... 62 1e-07 ref|XP_010503991.1| PREDICTED: aspartic proteinase nepenthesin-2... 62 1e-07 ref|XP_011046878.1| PREDICTED: aspartic proteinase nepenthesin-1... 62 2e-07 ref|XP_009139447.1| PREDICTED: aspartic proteinase nepenthesin-2... 62 2e-07 emb|CDY23221.1| BnaA04g05380D [Brassica napus] 62 2e-07 ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223... 62 2e-07 ref|XP_007162958.1| hypothetical protein PHAVU_001G194500g [Phas... 62 2e-07 ref|XP_006403798.1| hypothetical protein EUTSA_v10010339mg [Eutr... 62 2e-07 >ref|XP_006430085.1| hypothetical protein CICLE_v10011613mg [Citrus clementina] gi|557532142|gb|ESR43325.1| hypothetical protein CICLE_v10011613mg [Citrus clementina] Length = 483 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CLIL ++NAAG P GPAIILGDFQLQNF +EFDLANDRFGFAKQKCA Sbjct: 434 LCLILFTDNAAGPAPGGGPAIILGDFQLQNFYLEFDLANDRFGFAKQKCA 483 >gb|KDO36647.1| hypothetical protein CISIN_1g011566mg [Citrus sinensis] Length = 483 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CLIL ++NAAG GPAIILGDFQLQNF +EFDLANDRFGFAKQKCA Sbjct: 434 LCLILFTDNAAGPALGRGPAIILGDFQLQNFYLEFDLANDRFGFAKQKCA 483 >ref|XP_006481575.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Citrus sinensis] Length = 483 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CLIL ++NAAG GPAIILGDFQLQNF +EFDLANDRFGFAKQKCA Sbjct: 434 LCLILFTDNAAGPALGRGPAIILGDFQLQNFYLEFDLANDRFGFAKQKCA 483 >ref|XP_012468131.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Gossypium raimondii] gi|763749124|gb|KJB16563.1| hypothetical protein B456_002G236000 [Gossypium raimondii] Length = 468 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CL++ ++ G GPAIILG+FQ QN+ +EFDLAN+RFGFAK+ CA Sbjct: 419 VCLMIVTDKGVGEGARSGPAIILGNFQQQNYYIEFDLANNRFGFAKRNCA 468 >ref|XP_012485755.1| PREDICTED: aspartic proteinase nepenthesin-2 [Gossypium raimondii] gi|763769071|gb|KJB36286.1| hypothetical protein B456_006G150600 [Gossypium raimondii] Length = 468 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -2 Query: 341 CLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 CL++ S+N G+ GPAIILG FQ QN+ +EFD+AN+RFG+A+++CA Sbjct: 420 CLMIVSDNVVGQGSHGGPAIILGSFQQQNYYIEFDMANNRFGWAERRCA 468 >ref|XP_012074343.1| PREDICTED: aspartic proteinase nepenthesin-1 [Jatropha curcas] gi|643727839|gb|KDP36132.1| hypothetical protein JCGZ_08776 [Jatropha curcas] Length = 457 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = -2 Query: 344 ICLILASNNAA--GRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CL + S+N A G + GPAIILG+FQ QNF +E+DL NDRFGF KQ CA Sbjct: 406 VCLTIVSDNGATQGGRSGGGPAIILGNFQQQNFYIEYDLENDRFGFKKQSCA 457 >ref|XP_007027933.1| Eukaryotic aspartyl protease family protein, putative isoform 1 [Theobroma cacao] gi|590632770|ref|XP_007027934.1| Eukaryotic aspartyl protease family protein, putative isoform 1 [Theobroma cacao] gi|590632774|ref|XP_007027935.1| Eukaryotic aspartyl protease family protein, putative isoform 1 [Theobroma cacao] gi|508716538|gb|EOY08435.1| Eukaryotic aspartyl protease family protein, putative isoform 1 [Theobroma cacao] gi|508716539|gb|EOY08436.1| Eukaryotic aspartyl protease family protein, putative isoform 1 [Theobroma cacao] gi|508716540|gb|EOY08437.1| Eukaryotic aspartyl protease family protein, putative isoform 1 [Theobroma cacao] Length = 472 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 +CL++ ++N G+ GPAIILG+FQ QN+ +E+DLAN+ FGFAKQ C Sbjct: 423 VCLMVVTDNIIGQGVSGGPAIILGNFQQQNYYIEYDLANESFGFAKQSC 471 >ref|XP_006291053.1| hypothetical protein CARUB_v10017168mg [Capsella rubella] gi|482559760|gb|EOA23951.1| hypothetical protein CARUB_v10017168mg [Capsella rubella] Length = 471 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 +CL + S+N GPAIILG FQ QN+ VE+DL NDRFGFAK+KC Sbjct: 421 VCLTVVSDNTVNPSGGTGPAIILGSFQQQNYLVEYDLENDRFGFAKKKC 469 >ref|XP_014495153.1| PREDICTED: aspartic proteinase nepenthesin-2 [Vigna radiata var. radiata] Length = 462 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 +CL + S+ AG + GPAIILG++Q QNF++E+DL N+RFGF Q C Sbjct: 410 VCLTVVSDGGAGPAKMSGPAIILGNYQQQNFHIEYDLENERFGFGPQSC 458 >gb|KOM39095.1| hypothetical protein LR48_Vigan03g247700 [Vigna angularis] gi|920695871|gb|KOM39096.1| hypothetical protein LR48_Vigan03g247800 [Vigna angularis] Length = 465 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 +CL + S+ AG + GPAIILG++Q QNF++E+DL N+RFGF Q C Sbjct: 413 VCLTVVSDGGAGPAKMSGPAIILGNYQQQNFHIEYDLENERFGFGPQSC 461 >ref|XP_002877867.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata] gi|297323705|gb|EFH54126.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata] Length = 469 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CL + S+N GPAIILG FQ QN+ VE+DL NDRFGFAK+KC+ Sbjct: 419 VCLTVVSDNTVNPGGGTGPAIILGSFQQQNYLVEYDLENDRFGFAKKKCS 468 >ref|XP_011044027.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Populus euphratica] Length = 460 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 ICL + S+N AG GPAIILG++Q +NF VEFDL N++FGF +Q+CA Sbjct: 411 ICLTIVSDNVAGPGIGGGPAIILGNYQQRNFYVEFDLENEKFGFKQQRCA 460 >ref|XP_010515715.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Camelina sativa] Length = 472 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CL + S+N GPAIILG FQ QN+ VE+DL NDRFGFAK++C+ Sbjct: 422 VCLTVVSDNTVNPSGGTGPAIILGSFQQQNYLVEYDLENDRFGFAKKRCS 471 >ref|XP_010503991.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Camelina sativa] Length = 473 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CL + S+N GPAIILG FQ QN+ VE+DL NDRFGFAK++C+ Sbjct: 423 VCLTVVSDNTVNPSGGTGPAIILGSFQQQNYLVEYDLENDRFGFAKKRCS 472 >ref|XP_011046878.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Populus euphratica] Length = 476 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 ICL + S+N +G + GPAIILG++Q +NF VEFDL N+RFGF +Q C Sbjct: 426 ICLTIVSDNMSGSGIVGGPAIILGNYQQRNFYVEFDLKNERFGFKQQNC 474 >ref|XP_009139447.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Brassica rapa] Length = 473 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -2 Query: 344 ICLILASNN----AAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 +CL + S+N + GR GPAIILG FQ QN++VE+DL NDRFGFAK+KC Sbjct: 422 VCLTVVSDNTVSSSGGRS---GPAIILGSFQQQNYHVEYDLENDRFGFAKKKC 471 >emb|CDY23221.1| BnaA04g05380D [Brassica napus] Length = 473 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -2 Query: 344 ICLILASNN----AAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 +CL + S+N + GR GPAIILG FQ QN++VE+DL NDRFGFAK+KC Sbjct: 422 VCLTVVSDNTVSSSGGRS---GPAIILGSFQQQNYHVEYDLENDRFGFAKKKC 471 >ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223525662|gb|EEF28148.1| pepsin A, putative [Ricinus communis] Length = 468 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 5/55 (9%) Frame = -2 Query: 344 ICLILASNNAA-----GRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CL + S+NAA G GPAIILG+FQ QNF +E+DL NDRFGF +Q CA Sbjct: 414 VCLTIVSDNAAALGGDGGVRSSGPAIILGNFQQQNFYIEYDLENDRFGFKEQSCA 468 >ref|XP_007162958.1| hypothetical protein PHAVU_001G194500g [Phaseolus vulgaris] gi|561036422|gb|ESW34952.1| hypothetical protein PHAVU_001G194500g [Phaseolus vulgaris] Length = 466 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKC 198 +CL + S+ AG GPAIILG++Q QNF++E+DL N+RFGF Q C Sbjct: 414 VCLTIVSDGGAGPATTSGPAIILGNYQQQNFHIEYDLENERFGFGPQSC 462 >ref|XP_006403798.1| hypothetical protein EUTSA_v10010339mg [Eutrema salsugineum] gi|557104917|gb|ESQ45251.1| hypothetical protein EUTSA_v10010339mg [Eutrema salsugineum] Length = 471 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -2 Query: 344 ICLILASNNAAGRQPLYGPAIILGDFQLQNFNVEFDLANDRFGFAKQKCA 195 +CL + S +A G GPAIILG FQ QN++VE+DL NDRFGFA++KC+ Sbjct: 425 VCLTVVSADAGGS----GPAIILGSFQQQNYHVEYDLENDRFGFAQKKCS 470