BLASTX nr result
ID: Zanthoxylum22_contig00018623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00018623 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010101516.1| Ankyrin repeat-containing protein [Morus not... 60 8e-07 ref|XP_008463527.1| PREDICTED: ankyrin repeat-containing protein... 57 5e-06 ref|XP_004149816.1| PREDICTED: ankyrin repeat-containing protein... 57 5e-06 ref|XP_002526791.1| ankyrin repeat-containing protein, putative ... 56 9e-06 >ref|XP_010101516.1| Ankyrin repeat-containing protein [Morus notabilis] gi|587900173|gb|EXB88513.1| Ankyrin repeat-containing protein [Morus notabilis] Length = 584 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 377 MRKREKSRTRSGSTSWHQSDFSNSEIDRIYAL 282 MRKREKS RSGS SWH SDFSNSEIDRIYAL Sbjct: 553 MRKREKSAKRSGSNSWHHSDFSNSEIDRIYAL 584 >ref|XP_008463527.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Cucumis melo] Length = 590 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 377 MRKREKSRTRSGSTSWHQSDFSNSEIDRIYAL 282 +RK+EKS RSGS SWH SDFSNSE+DRIYAL Sbjct: 559 IRKKEKSNRRSGSNSWHHSDFSNSEVDRIYAL 590 >ref|XP_004149816.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Cucumis sativus] gi|700196081|gb|KGN51258.1| hypothetical protein Csa_5G505190 [Cucumis sativus] Length = 590 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 377 MRKREKSRTRSGSTSWHQSDFSNSEIDRIYAL 282 +RK+EKS RSGS SWH SDFSNSE+DRIYAL Sbjct: 559 VRKKEKSNRRSGSNSWHHSDFSNSEVDRIYAL 590 >ref|XP_002526791.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223533867|gb|EEF35597.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 570 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 377 MRKREKSRTRSGSTSWHQSDFSNSEIDRIYAL 282 MRKREKS RSGS SW SDFSNSE+DRIYAL Sbjct: 539 MRKREKSARRSGSNSWQHSDFSNSEVDRIYAL 570