BLASTX nr result
ID: Zanthoxylum22_contig00018466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00018466 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006449270.1| hypothetical protein CICLE_v10017033mg [Citr... 62 1e-07 ref|XP_012091541.1| PREDICTED: uncharacterized protein At5g65660... 59 1e-06 ref|XP_002521409.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_010107061.1| hypothetical protein L484_002472 [Morus nota... 57 5e-06 ref|XP_010095807.1| hypothetical protein L484_022163 [Morus nota... 57 7e-06 ref|XP_002305673.2| hypothetical protein POPTR_0004s03750g [Popu... 57 7e-06 ref|XP_008224988.1| PREDICTED: uncharacterized protein At5g65660... 56 9e-06 >ref|XP_006449270.1| hypothetical protein CICLE_v10017033mg [Citrus clementina] gi|568827004|ref|XP_006467858.1| PREDICTED: uncharacterized protein At5g65660-like [Citrus sinensis] gi|557551881|gb|ESR62510.1| hypothetical protein CICLE_v10017033mg [Citrus clementina] Length = 157 Score = 62.4 bits (150), Expect = 1e-07 Identities = 36/66 (54%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -3 Query: 356 PSPKMTVYANGVSVLMPGNNIPTFIAHXXXXXXXXXPISLP-FQHXXXXXXXXXXXXXXX 180 PSP+MT+YANGVSVLMPG+NIPTFIAH ISLP QH Sbjct: 91 PSPRMTIYANGVSVLMPGDNIPTFIAHPAPVPCPPTRISLPDNQHIPLPNPLSCSNSSRS 150 Query: 179 SIQEDS 162 SIQEDS Sbjct: 151 SIQEDS 156 >ref|XP_012091541.1| PREDICTED: uncharacterized protein At5g65660 [Jatropha curcas] gi|643703851|gb|KDP20915.1| hypothetical protein JCGZ_21386 [Jatropha curcas] Length = 156 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 30/43 (69%) Frame = -3 Query: 356 PSPKMTVYANGVSVLMPGNNIPTFIAHXXXXXXXXXPISLPFQ 228 PSPKMTVYANGVSVLMPG+NIPTFIAH I P Q Sbjct: 85 PSPKMTVYANGVSVLMPGDNIPTFIAHPAPVPCPPKRICCPHQ 127 >ref|XP_002521409.1| conserved hypothetical protein [Ricinus communis] gi|223539308|gb|EEF40899.1| conserved hypothetical protein [Ricinus communis] Length = 157 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 356 PSPKMTVYANGVSVLMPGNNIPTFIAH 276 PSPKMTVYANGVSVLMPG+NIPTFIAH Sbjct: 87 PSPKMTVYANGVSVLMPGDNIPTFIAH 113 >ref|XP_010107061.1| hypothetical protein L484_002472 [Morus notabilis] gi|587968898|gb|EXC53902.1| hypothetical protein L484_002472 [Morus notabilis] Length = 158 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -3 Query: 356 PSPKMTVYANGVSVLMPGNNIPTFIAHXXXXXXXXXPISLPFQH 225 PSPKMT+YA+GVSVLMPG+NIPTFIAH +S P QH Sbjct: 91 PSPKMTIYASGVSVLMPGDNIPTFIAHPAPVPCPPDRVSWP-QH 133 >ref|XP_010095807.1| hypothetical protein L484_022163 [Morus notabilis] gi|587873073|gb|EXB62275.1| hypothetical protein L484_022163 [Morus notabilis] Length = 159 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -3 Query: 356 PSPKMTVYANGVSVLMPGNNIPTFIAHXXXXXXXXXPISLPF 231 PSPKMTVYA GVSVLMPG IPTFIAH IS PF Sbjct: 96 PSPKMTVYARGVSVLMPGEEIPTFIAHPAPAPCPPEGISRPF 137 >ref|XP_002305673.2| hypothetical protein POPTR_0004s03750g [Populus trichocarpa] gi|550340257|gb|EEE86184.2| hypothetical protein POPTR_0004s03750g [Populus trichocarpa] Length = 157 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 356 PSPKMTVYANGVSVLMPGNNIPTFIAH 276 PSPKMTVY NGVSVLMPG+NIPTFIAH Sbjct: 87 PSPKMTVYTNGVSVLMPGDNIPTFIAH 113 >ref|XP_008224988.1| PREDICTED: uncharacterized protein At5g65660 [Prunus mume] Length = 169 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -3 Query: 356 PSPKMTVYANGVSVLMPGNNIPTFIAHXXXXXXXXXPISLPFQH 225 PSPKMTVYA+GVSVLMPG++IPTFIAH I LP QH Sbjct: 94 PSPKMTVYASGVSVLMPGDDIPTFIAHPAPVPCPPERICLP-QH 136