BLASTX nr result
ID: Zanthoxylum22_contig00017089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00017089 (432 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO71871.1| hypothetical protein CISIN_1g029453mg [Citrus sin... 70 5e-10 ref|XP_006419420.1| hypothetical protein CICLE_v10005438mg [Citr... 70 5e-10 ref|XP_014509116.1| PREDICTED: GTP-binding protein SAR1A-like [V... 70 6e-10 gb|KOM33447.1| hypothetical protein LR48_Vigan01g300300 [Vigna a... 70 6e-10 ref|XP_010094317.1| GTP-binding protein [Morus notabilis] gi|587... 70 6e-10 gb|KHN03311.1| GTP-binding protein SAR1A [Glycine soja] 70 6e-10 gb|KFK30774.1| hypothetical protein AALP_AA6G024500 [Arabis alpina] 70 6e-10 ref|XP_004487786.1| PREDICTED: GTP-binding protein SAR1A [Cicer ... 70 6e-10 ref|XP_003594789.1| Ras-related small GTP-binding family protein... 70 6e-10 ref|NP_001241165.1| uncharacterized protein LOC100811178 [Glycin... 70 6e-10 ref|NP_001239916.1| uncharacterized protein LOC100815670 [Glycin... 70 6e-10 ref|XP_003609752.1| Ras-related small GTP-binding family protein... 70 6e-10 ref|XP_007035749.1| Ras-related small GTP-binding family protein... 70 8e-10 ref|XP_009382504.1| PREDICTED: GTP-binding protein SAR1A-like [M... 69 1e-09 ref|XP_009411637.1| PREDICTED: GTP-binding protein SAR1A-like [M... 69 1e-09 ref|XP_014499158.1| PREDICTED: GTP-binding protein SAR1A [Vigna ... 69 1e-09 gb|KHN12896.1| GTP-binding protein SAR1A [Glycine soja] gi|94708... 69 1e-09 gb|KHN14662.1| GTP-binding protein SAR1A [Glycine soja] gi|94706... 69 1e-09 ref|XP_008451486.1| PREDICTED: GTP-binding protein SAR1A [Cucumi... 69 1e-09 ref|XP_002515297.1| GTP-binding protein sar1, putative [Ricinus ... 69 1e-09 >gb|KDO71871.1| hypothetical protein CISIN_1g029453mg [Citrus sinensis] Length = 193 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 432 DDTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+TNVRPLEVFMCSIVRKMGYGEGF+WLSQYIK Sbjct: 161 DNTNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 193 >ref|XP_006419420.1| hypothetical protein CICLE_v10005438mg [Citrus clementina] gi|557521293|gb|ESR32660.1| hypothetical protein CICLE_v10005438mg [Citrus clementina] Length = 321 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 432 DDTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+TNVRPLEVFMCSIVRKMGYGEGF+WLSQYIK Sbjct: 289 DNTNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 321 >ref|XP_014509116.1| PREDICTED: GTP-binding protein SAR1A-like [Vigna radiata var. radiata] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >gb|KOM33447.1| hypothetical protein LR48_Vigan01g300300 [Vigna angularis] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >ref|XP_010094317.1| GTP-binding protein [Morus notabilis] gi|587866259|gb|EXB55737.1| GTP-binding protein [Morus notabilis] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 DTNVRPLEVFMCSIVRKMGYGEGF+WLSQYIK Sbjct: 162 DTNVRPLEVFMCSIVRKMGYGEGFRWLSQYIK 193 >gb|KHN03311.1| GTP-binding protein SAR1A [Glycine soja] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >gb|KFK30774.1| hypothetical protein AALP_AA6G024500 [Arabis alpina] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 DTNVRPLEVFMCSIVRKMGYGEGF+WLSQYIK Sbjct: 162 DTNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 193 >ref|XP_004487786.1| PREDICTED: GTP-binding protein SAR1A [Cicer arietinum] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >ref|XP_003594789.1| Ras-related small GTP-binding family protein [Medicago truncatula] gi|355483837|gb|AES65040.1| Ras-related small GTP-binding family protein [Medicago truncatula] gi|388509862|gb|AFK42997.1| unknown [Medicago truncatula] gi|388516193|gb|AFK46158.1| unknown [Medicago truncatula] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >ref|NP_001241165.1| uncharacterized protein LOC100811178 [Glycine max] gi|255645912|gb|ACU23445.1| unknown [Glycine max] gi|734318109|gb|KHN02912.1| GTP-binding protein SAR1A [Glycine soja] gi|947102268|gb|KRH50760.1| hypothetical protein GLYMA_07G241900 [Glycine max] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >ref|NP_001239916.1| uncharacterized protein LOC100815670 [Glycine max] gi|255634824|gb|ACU17772.1| unknown [Glycine max] gi|947052875|gb|KRH02328.1| hypothetical protein GLYMA_17G032000 [Glycine max] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >ref|XP_003609752.1| Ras-related small GTP-binding family protein [Medicago truncatula] gi|355510807|gb|AES91949.1| Ras-related small GTP-binding family protein [Medicago truncatula] gi|388510924|gb|AFK43528.1| unknown [Medicago truncatula] Length = 193 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+NVRPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >ref|XP_007035749.1| Ras-related small GTP-binding family protein [Theobroma cacao] gi|508714778|gb|EOY06675.1| Ras-related small GTP-binding family protein [Theobroma cacao] Length = 193 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 432 DDTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D TNVRPLEVFMCSIVRKMGYGEGF+WLSQYIK Sbjct: 161 DGTNVRPLEVFMCSIVRKMGYGEGFRWLSQYIK 193 >ref|XP_009382504.1| PREDICTED: GTP-binding protein SAR1A-like [Musa acuminata subsp. malaccensis] Length = 193 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 DTNVRPLEVFMCSIVRKMGYGEGF+W+SQYIK Sbjct: 162 DTNVRPLEVFMCSIVRKMGYGEGFRWMSQYIK 193 >ref|XP_009411637.1| PREDICTED: GTP-binding protein SAR1A-like [Musa acuminata subsp. malaccensis] Length = 193 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 DTNVRPLEVFMCSIVRKMGYGEGF+W+SQYIK Sbjct: 162 DTNVRPLEVFMCSIVRKMGYGEGFRWMSQYIK 193 >ref|XP_014499158.1| PREDICTED: GTP-binding protein SAR1A [Vigna radiata var. radiata] gi|920682390|gb|KOM29162.1| hypothetical protein LR48_Vigan635s008700 [Vigna angularis] Length = 193 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+N+RPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNLRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >gb|KHN12896.1| GTP-binding protein SAR1A [Glycine soja] gi|947088343|gb|KRH37008.1| hypothetical protein GLYMA_09G038200 [Glycine max] Length = 193 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+N+RPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNLRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >gb|KHN14662.1| GTP-binding protein SAR1A [Glycine soja] gi|947062719|gb|KRH11980.1| hypothetical protein GLYMA_15G143300 [Glycine max] Length = 193 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 D+N+RPLEVFMCSIVRKMGYGEGFQWLSQYIK Sbjct: 162 DSNLRPLEVFMCSIVRKMGYGEGFQWLSQYIK 193 >ref|XP_008451486.1| PREDICTED: GTP-binding protein SAR1A [Cucumis melo] Length = 193 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 DTNVRPLEVFMCSIVRKMGYG+GF+WLSQYIK Sbjct: 162 DTNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193 >ref|XP_002515297.1| GTP-binding protein sar1, putative [Ricinus communis] gi|223545777|gb|EEF47281.1| GTP-binding protein sar1, putative [Ricinus communis] Length = 193 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 429 DTNVRPLEVFMCSIVRKMGYGEGFQWLSQYIK 334 DTNVRPLEVFMCSIVRKMGYG+GF+WLSQYIK Sbjct: 162 DTNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK 193