BLASTX nr result
ID: Zanthoxylum22_contig00016932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00016932 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF11313.1| hypothetical protein SEPMUDRAFT_150277 [Sphaeruli... 60 8e-07 gb|EME41763.1| hypothetical protein DOTSEDRAFT_73980 [Dothistrom... 56 9e-06 >gb|EMF11313.1| hypothetical protein SEPMUDRAFT_150277 [Sphaerulina musiva SO2202] Length = 299 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 344 GTQLFFDLFVAMSNHIDDVVEVGNGRSPSIDK 249 GTQ+FFDLFVAMSNHIDDVVE+GN RSP ++K Sbjct: 268 GTQMFFDLFVAMSNHIDDVVELGNARSPDLNK 299 >gb|EME41763.1| hypothetical protein DOTSEDRAFT_73980 [Dothistroma septosporum NZE10] Length = 294 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 344 GTQLFFDLFVAMSNHIDDVVEVGNGRSPSIDK 249 GTQLFFDLFVAM NHIDDVVE+G G SP++ K Sbjct: 263 GTQLFFDLFVAMCNHIDDVVELGQGSSPALSK 294