BLASTX nr result
ID: Zanthoxylum22_contig00016472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00016472 (1340 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO39045.1| hypothetical protein CISIN_1g001348mg [Citrus sin... 54 2e-06 >gb|KDO39045.1| hypothetical protein CISIN_1g001348mg [Citrus sinensis] Length = 1094 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 948 LNWEEKNIFLHIACFLRGEKRHNLTMILEDYYSVHY 841 LNWE KN+FL IACF +GE + +T+IL+++YSVHY Sbjct: 333 LNWEAKNLFLDIACFFKGEDINFVTLILDNHYSVHY 368 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 811 QMHDLLHEGDREILHQASITKRGNHSKI 728 +MHDLL + REI+ Q S + G S++ Sbjct: 387 EMHDLLQDMGREIVSQESEKEPGKRSRL 414