BLASTX nr result
ID: Zanthoxylum22_contig00016358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00016358 (348 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO39061.1| hypothetical protein CISIN_1g032812mg [Citrus sin... 62 1e-07 ref|XP_006481719.1| PREDICTED: glycine-rich RNA-binding protein ... 62 1e-07 ref|XP_006481718.1| PREDICTED: glycine-rich RNA-binding protein ... 62 1e-07 ref|XP_006481717.1| PREDICTED: glycine-rich RNA-binding protein ... 62 1e-07 ref|XP_006430133.1| hypothetical protein CICLE_v10012994mg [Citr... 62 1e-07 ref|XP_006430132.1| hypothetical protein CICLE_v10012994mg [Citr... 62 1e-07 ref|XP_006430131.1| hypothetical protein CICLE_v10012994mg [Citr... 62 1e-07 >gb|KDO39061.1| hypothetical protein CISIN_1g032812mg [Citrus sinensis] Length = 133 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 348 AKPKTNYSRGGIPIARGPPDSISDRVRVNFFHEEPNTHKS 229 AKPKT++ R G+PIARGPP+SI+DRV+VNFF EEP T KS Sbjct: 95 AKPKTSF-RSGMPIARGPPESIADRVKVNFFDEEPKTQKS 133 >ref|XP_006481719.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like isoform X3 [Citrus sinensis] Length = 131 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 348 AKPKTNYSRGGIPIARGPPDSISDRVRVNFFHEEPNTHKS 229 AKPKT++ R G+PIARGPP+SI+DRV+VNFF EEP T KS Sbjct: 93 AKPKTSF-RSGMPIARGPPESIADRVKVNFFDEEPKTQKS 131 >ref|XP_006481718.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like isoform X2 [Citrus sinensis] gi|641851655|gb|KDO70525.1| hypothetical protein CISIN_1g032528mg [Citrus sinensis] Length = 139 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 348 AKPKTNYSRGGIPIARGPPDSISDRVRVNFFHEEPNTHKS 229 AKPKT++ R G+PIARGPP+SI+DRV+VNFF EEP T KS Sbjct: 101 AKPKTSF-RSGMPIARGPPESIADRVKVNFFDEEPKTQKS 139 >ref|XP_006481717.1| PREDICTED: glycine-rich RNA-binding protein 3, mitochondrial-like isoform X1 [Citrus sinensis] Length = 155 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 348 AKPKTNYSRGGIPIARGPPDSISDRVRVNFFHEEPNTHKS 229 AKPKT++ R G+PIARGPP+SI+DRV+VNFF EEP T KS Sbjct: 117 AKPKTSF-RSGMPIARGPPESIADRVKVNFFDEEPKTQKS 155 >ref|XP_006430133.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] gi|557532190|gb|ESR43373.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] Length = 131 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 348 AKPKTNYSRGGIPIARGPPDSISDRVRVNFFHEEPNTHKS 229 AKPKT++ R G+PIARGPP+SI+DRV+VNFF EEP T KS Sbjct: 93 AKPKTSF-RSGMPIARGPPESIADRVKVNFFDEEPKTQKS 131 >ref|XP_006430132.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] gi|557532189|gb|ESR43372.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] Length = 155 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 348 AKPKTNYSRGGIPIARGPPDSISDRVRVNFFHEEPNTHKS 229 AKPKT++ R G+PIARGPP+SI+DRV+VNFF EEP T KS Sbjct: 117 AKPKTSF-RSGMPIARGPPESIADRVKVNFFDEEPKTQKS 155 >ref|XP_006430131.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] gi|557532188|gb|ESR43371.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] Length = 139 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 348 AKPKTNYSRGGIPIARGPPDSISDRVRVNFFHEEPNTHKS 229 AKPKT++ R G+PIARGPP+SI+DRV+VNFF EEP T KS Sbjct: 101 AKPKTSF-RSGMPIARGPPESIADRVKVNFFDEEPKTQKS 139