BLASTX nr result
ID: Zanthoxylum22_contig00016056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00016056 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMS99639.1| hypothetical protein BVRB_1g022080 [Beta vulgaris... 59 1e-06 >gb|KMS99639.1| hypothetical protein BVRB_1g022080 [Beta vulgaris subsp. vulgaris] Length = 339 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Frame = -2 Query: 176 DVLQSSSNKRSRTTSHCWDHFTKITVHGETMAKCIHC--VHDLKAGSGTSHLNRH-VKTC 6 ++L +S+ K + TS WDHF +I V+GE AKC+HC + K +GTSHL H VK C Sbjct: 70 EILSTSTRKGRKLTSPVWDHFERIDVNGEKKAKCLHCDKLMSAKGSNGTSHLRDHMVKRC 129 Query: 5 L 3 + Sbjct: 130 I 130