BLASTX nr result
ID: Zanthoxylum22_contig00014449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00014449 (485 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007221011.1| hypothetical protein PRUPE_ppa002374mg [Prun... 99 2e-18 ref|XP_008233636.1| PREDICTED: telomere repeat-binding protein 3... 95 2e-17 ref|XP_012089031.1| PREDICTED: telomere repeat-binding protein 4... 95 2e-17 ref|XP_012089023.1| PREDICTED: telomere repeat-binding protein 4... 95 2e-17 ref|XP_012089039.1| PREDICTED: telomere repeat-binding protein 4... 95 2e-17 ref|XP_010658557.1| PREDICTED: telomere repeat-binding protein 4... 94 4e-17 ref|XP_010658554.1| PREDICTED: telomere repeat-binding protein 4... 94 4e-17 emb|CBI31661.3| unnamed protein product [Vitis vinifera] 94 4e-17 emb|CAN72738.1| hypothetical protein VITISV_021864 [Vitis vinifera] 94 4e-17 ref|XP_012453630.1| PREDICTED: telomere repeat-binding protein 3... 93 7e-17 gb|KJB73979.1| hypothetical protein B456_011G266100 [Gossypium r... 93 7e-17 gb|KJB73978.1| hypothetical protein B456_011G266100 [Gossypium r... 93 7e-17 ref|XP_007009226.1| Telomeric DNA binding protein 1, putative is... 93 7e-17 ref|XP_010096584.1| Telomere repeat-binding protein 4 [Morus not... 92 1e-16 ref|XP_013460685.1| double-strand telomere-binding protein, puta... 92 1e-16 ref|XP_004503150.1| PREDICTED: telomere repeat-binding protein 4... 92 1e-16 ref|XP_014495232.1| PREDICTED: telomere repeat-binding protein 3... 92 2e-16 gb|KOM39198.1| hypothetical protein LR48_Vigan03g258000 [Vigna a... 92 2e-16 gb|KHN17923.1| Telomere repeat-binding protein 3 [Glycine soja] 92 2e-16 ref|XP_009343592.1| PREDICTED: telomere repeat-binding protein 3... 92 2e-16 >ref|XP_007221011.1| hypothetical protein PRUPE_ppa002374mg [Prunus persica] gi|462417473|gb|EMJ22210.1| hypothetical protein PRUPE_ppa002374mg [Prunus persica] Length = 680 Score = 98.6 bits (244), Expect = 2e-18 Identities = 45/65 (69%), Positives = 53/65 (81%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGILN 194 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH+YW Q QAKQHG H+ GI+ Sbjct: 610 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLAAHSYWCQHQAKQHGKHQGGIMK 669 Query: 193 ENGSP 179 +P Sbjct: 670 ITEAP 674 >ref|XP_008233636.1| PREDICTED: telomere repeat-binding protein 3-like [Prunus mume] Length = 692 Score = 95.1 bits (235), Expect = 2e-17 Identities = 44/65 (67%), Positives = 51/65 (78%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGILN 194 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH+YW Q QAKQHG H I+ Sbjct: 622 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLAAHSYWCQHQAKQHGKHPGSIMK 681 Query: 193 ENGSP 179 +P Sbjct: 682 ITEAP 686 >ref|XP_012089031.1| PREDICTED: telomere repeat-binding protein 4 isoform X2 [Jatropha curcas] Length = 712 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/59 (71%), Positives = 52/59 (88%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGIL 197 T + ++DKWKTLVHTAKI+PQ+RRGE VPQELLDRVL AH YW+Q QAKQHG +++G+L Sbjct: 633 TYVDLKDKWKTLVHTAKIAPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQHGKNQAGVL 691 >ref|XP_012089023.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Jatropha curcas] Length = 713 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/59 (71%), Positives = 52/59 (88%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGIL 197 T + ++DKWKTLVHTAKI+PQ+RRGE VPQELLDRVL AH YW+Q QAKQHG +++G+L Sbjct: 634 TYVDLKDKWKTLVHTAKIAPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQHGKNQAGVL 692 >ref|XP_012089039.1| PREDICTED: telomere repeat-binding protein 4 isoform X3 [Jatropha curcas] gi|643739125|gb|KDP44939.1| hypothetical protein JCGZ_01439 [Jatropha curcas] Length = 709 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/59 (71%), Positives = 52/59 (88%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGIL 197 T + ++DKWKTLVHTAKI+PQ+RRGE VPQELLDRVL AH YW+Q QAKQHG +++G+L Sbjct: 630 TYVDLKDKWKTLVHTAKIAPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQHGKNQAGVL 688 >ref|XP_010658557.1| PREDICTED: telomere repeat-binding protein 4 isoform X2 [Vitis vinifera] Length = 704 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGILN 194 T + ++DKWKTLVHTA+ISPQ+RRGE VPQE+LDRVL+AH YW++ QAKQHG H+ G L Sbjct: 630 TYVDLKDKWKTLVHTARISPQQRRGEPVPQEVLDRVLSAHAYWSEHQAKQHGKHQVGTLR 689 Query: 193 ENG 185 G Sbjct: 690 ITG 692 >ref|XP_010658554.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis vinifera] gi|731412993|ref|XP_010658555.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis vinifera] gi|731412995|ref|XP_010658556.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis vinifera] Length = 706 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGILN 194 T + ++DKWKTLVHTA+ISPQ+RRGE VPQE+LDRVL+AH YW++ QAKQHG H+ G L Sbjct: 632 TYVDLKDKWKTLVHTARISPQQRRGEPVPQEVLDRVLSAHAYWSEHQAKQHGKHQVGTLR 691 Query: 193 ENG 185 G Sbjct: 692 ITG 694 >emb|CBI31661.3| unnamed protein product [Vitis vinifera] Length = 681 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGILN 194 T + ++DKWKTLVHTA+ISPQ+RRGE VPQE+LDRVL+AH YW++ QAKQHG H+ G L Sbjct: 607 TYVDLKDKWKTLVHTARISPQQRRGEPVPQEVLDRVLSAHAYWSEHQAKQHGKHQVGTLR 666 Query: 193 ENG 185 G Sbjct: 667 ITG 669 >emb|CAN72738.1| hypothetical protein VITISV_021864 [Vitis vinifera] Length = 672 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/63 (66%), Positives = 52/63 (82%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGILN 194 T + ++DKWKTLVHTA+ISPQ+RRGE VPQE+LDRVL+AH YW++ QAKQHG H+ G L Sbjct: 598 TYVDLKDKWKTLVHTARISPQQRRGEPVPQEVLDRVLSAHAYWSEHQAKQHGKHQVGTLR 657 Query: 193 ENG 185 G Sbjct: 658 ITG 660 >ref|XP_012453630.1| PREDICTED: telomere repeat-binding protein 3 [Gossypium raimondii] Length = 675 Score = 93.2 bits (230), Expect = 7e-17 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGIL 197 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH YW+Q QAKQ G H+ G L Sbjct: 597 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQQGKHQPGTL 655 >gb|KJB73979.1| hypothetical protein B456_011G266100 [Gossypium raimondii] Length = 539 Score = 93.2 bits (230), Expect = 7e-17 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGIL 197 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH YW+Q QAKQ G H+ G L Sbjct: 461 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQQGKHQPGTL 519 >gb|KJB73978.1| hypothetical protein B456_011G266100 [Gossypium raimondii] Length = 683 Score = 93.2 bits (230), Expect = 7e-17 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGIL 197 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH YW+Q QAKQ G H+ G L Sbjct: 605 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQQGKHQPGTL 663 >ref|XP_007009226.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma cacao] gi|508726139|gb|EOY18036.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma cacao] Length = 708 Score = 93.2 bits (230), Expect = 7e-17 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGIL 197 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH YW+Q QAKQ G H +G L Sbjct: 629 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQQGKHHAGTL 687 >ref|XP_010096584.1| Telomere repeat-binding protein 4 [Morus notabilis] gi|587876160|gb|EXB65252.1| Telomere repeat-binding protein 4 [Morus notabilis] Length = 693 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/65 (67%), Positives = 51/65 (78%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESGILN 194 T + ++DKWKTLVHTA ISPQ+RRGE VPQELLDRVL AH YW+Q QAKQHG +SG L Sbjct: 606 TYVDLKDKWKTLVHTATISPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQHGKPQSGTLK 665 Query: 193 ENGSP 179 +P Sbjct: 666 IAQAP 670 >ref|XP_013460685.1| double-strand telomere-binding protein, putative [Medicago truncatula] gi|657393967|gb|KEH34719.1| double-strand telomere-binding protein, putative [Medicago truncatula] Length = 645 Score = 92.4 bits (228), Expect = 1e-16 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESG 203 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH YW+Q Q KQHG H+ G Sbjct: 571 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLGAHAYWSQHQIKQHGKHQCG 627 >ref|XP_004503150.1| PREDICTED: telomere repeat-binding protein 4-like [Cicer arietinum] Length = 682 Score = 92.4 bits (228), Expect = 1e-16 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESG 203 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH YW+Q Q KQHG H+ G Sbjct: 606 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLGAHAYWSQHQIKQHGKHQCG 662 >ref|XP_014495232.1| PREDICTED: telomere repeat-binding protein 3-like [Vigna radiata var. radiata] Length = 681 Score = 92.0 bits (227), Expect = 2e-16 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESG 203 T + ++DKWKTLVHTA ISPQ+RRGE VPQELLDRVL AH +W+Q QAKQHG H++G Sbjct: 608 TYVDLKDKWKTLVHTATISPQQRRGEPVPQELLDRVLAAHAFWSQHQAKQHGKHQAG 664 >gb|KOM39198.1| hypothetical protein LR48_Vigan03g258000 [Vigna angularis] Length = 650 Score = 92.0 bits (227), Expect = 2e-16 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESG 203 T + ++DKWKTLVHTA ISPQ+RRGE VPQELLDRVL AH +W+Q QAKQHG H++G Sbjct: 577 TYVDLKDKWKTLVHTATISPQQRRGEPVPQELLDRVLAAHAFWSQHQAKQHGKHQAG 633 >gb|KHN17923.1| Telomere repeat-binding protein 3 [Glycine soja] Length = 676 Score = 92.0 bits (227), Expect = 2e-16 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMHESG 203 T + ++DKWKTLVHTA ISPQ+RRGE VPQELLDRVL AH +W+Q QAKQHG H++G Sbjct: 603 TYVDLKDKWKTLVHTATISPQQRRGEPVPQELLDRVLAAHAFWSQHQAKQHGKHQAG 659 >ref|XP_009343592.1| PREDICTED: telomere repeat-binding protein 3-like [Pyrus x bretschneideri] Length = 677 Score = 92.0 bits (227), Expect = 2e-16 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -2 Query: 373 T*LSVQDKWKTLVHTAKISPQRRRGEAVPQELLDRVLTAHTYWTQLQAKQHGMH 212 T + ++DKWKTLVHTAKISPQ+RRGE VPQELLDRVL AH+YW Q QAKQHG H Sbjct: 618 TYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLDRVLAAHSYWCQHQAKQHGKH 671