BLASTX nr result
ID: Zanthoxylum22_contig00013322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00013322 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466149.1| PREDICTED: uncharacterized protein LOC102616... 67 7e-09 ref|XP_006426643.1| hypothetical protein CICLE_v10024687mg [Citr... 67 7e-09 >ref|XP_006466149.1| PREDICTED: uncharacterized protein LOC102616717 [Citrus sinensis] Length = 440 Score = 66.6 bits (161), Expect = 7e-09 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 308 KIVAGSQLRDNFVGLYDWSSNSGLSAPQRHALERLAIT 195 KIVA SQLRDNFVGLYD SSNSGLSAPQR LERLAIT Sbjct: 78 KIVASSQLRDNFVGLYDSSSNSGLSAPQRRVLERLAIT 115 >ref|XP_006426643.1| hypothetical protein CICLE_v10024687mg [Citrus clementina] gi|557528633|gb|ESR39883.1| hypothetical protein CICLE_v10024687mg [Citrus clementina] Length = 1849 Score = 66.6 bits (161), Expect = 7e-09 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 308 KIVAGSQLRDNFVGLYDWSSNSGLSAPQRHALERLAIT 195 KIVA SQLRDNFVGLYD SSNSGLSAPQR LERLAIT Sbjct: 78 KIVASSQLRDNFVGLYDSSSNSGLSAPQRRVLERLAIT 115