BLASTX nr result
ID: Zanthoxylum22_contig00013154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00013154 (1170 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004512843.1| PREDICTED: mediator-associated protein 1-lik... 68 1e-08 gb|AGC78985.1| hypothetical protein (mitochondrion) [Vicia faba] 68 1e-08 >ref|XP_004512843.1| PREDICTED: mediator-associated protein 1-like [Cicer arietinum] Length = 231 Score = 68.2 bits (165), Expect = 1e-08 Identities = 36/53 (67%), Positives = 37/53 (69%), Gaps = 9/53 (16%) Frame = +2 Query: 17 LTKRWFYPGQATKAG---GNSER------EAG*RNWSTHQAHDLKTAGSNPVP 148 LTKRWFYPGQATKAG GN ER EAG +W T QAHDLK AGSNP P Sbjct: 176 LTKRWFYPGQATKAGDLGGNRERKEREGEEAGWSSWLTRQAHDLKIAGSNPAP 228 >gb|AGC78985.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 198 Score = 68.2 bits (165), Expect = 1e-08 Identities = 38/60 (63%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = +2 Query: 134 SNPVPDIVLRRCPLGERGHHSLSFFNRSDQDK*NGLVS*ETAQD----QDVCKKVLCVRG 301 S PVPDIVLRRCPLGERGHH LSFFNRSDQDK G V T V +KV+ RG Sbjct: 40 SPPVPDIVLRRCPLGERGHHYLSFFNRSDQDKWVGFVLLSTQFSVFVRDHVGRKVVSCRG 99