BLASTX nr result
ID: Zanthoxylum22_contig00013103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00013103 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469046.1| PREDICTED: transcription factor TCP4-like is... 121 2e-25 ref|XP_006446753.1| hypothetical protein CICLE_v10015871mg [Citr... 121 2e-25 ref|XP_010035834.1| PREDICTED: transcription factor TCP4-like [E... 119 9e-25 ref|XP_009357156.1| PREDICTED: transcription factor TCP4-like [P... 118 2e-24 ref|XP_008381571.1| PREDICTED: transcription factor TCP4-like [M... 118 2e-24 ref|XP_014522077.1| PREDICTED: transcription factor TCP4-like [V... 116 6e-24 gb|KOM43760.1| hypothetical protein LR48_Vigan05g136500 [Vigna a... 116 6e-24 ref|XP_011002677.1| PREDICTED: transcription factor TCP4-like [P... 116 6e-24 ref|XP_002325583.1| hypothetical protein POPTR_0019s12110g [Popu... 116 6e-24 ref|XP_007149767.1| hypothetical protein PHAVU_005G097200g [Phas... 116 6e-24 ref|XP_004487176.1| PREDICTED: transcription factor TCP4-like [C... 116 6e-24 ref|XP_003543311.1| PREDICTED: transcription factor TCP4-like is... 116 6e-24 gb|ACU20384.1| unknown [Glycine max] 116 6e-24 ref|XP_002525139.1| transcription factor, putative [Ricinus comm... 115 1e-23 gb|KHN27924.1| Transcription factor TCP4 [Glycine soja] 115 1e-23 ref|XP_004303161.1| PREDICTED: transcription factor TCP4-like [F... 115 1e-23 ref|XP_003540389.1| PREDICTED: transcription factor TCP4-like [G... 115 1e-23 ref|XP_013465197.1| TCP family transcription factor [Medicago tr... 115 1e-23 ref|XP_009354282.1| PREDICTED: transcription factor TCP4-like [P... 115 2e-23 ref|XP_008342868.1| PREDICTED: transcription factor TCP4-like [M... 115 2e-23 >ref|XP_006469046.1| PREDICTED: transcription factor TCP4-like isoform X1 [Citrus sinensis] gi|568829473|ref|XP_006469047.1| PREDICTED: transcription factor TCP4-like isoform X2 [Citrus sinensis] gi|641826559|gb|KDO45776.1| hypothetical protein CISIN_1g019898mg [Citrus sinensis] gi|641826560|gb|KDO45777.1| hypothetical protein CISIN_1g019898mg [Citrus sinensis] Length = 334 Score = 121 bits (304), Expect = 2e-25 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMKG+EGEIVQV+GGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKGTEGEIVQVEGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_006446753.1| hypothetical protein CICLE_v10015871mg [Citrus clementina] gi|557549364|gb|ESR59993.1| hypothetical protein CICLE_v10015871mg [Citrus clementina] Length = 334 Score = 121 bits (304), Expect = 2e-25 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMKG+EGEIVQV+GGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKGTEGEIVQVEGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_010035834.1| PREDICTED: transcription factor TCP4-like [Eucalyptus grandis] gi|629080855|gb|KCW47300.1| hypothetical protein EUGRSUZ_K01089 [Eucalyptus grandis] Length = 358 Score = 119 bits (298), Expect = 9e-25 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK +EGEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTEGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_009357156.1| PREDICTED: transcription factor TCP4-like [Pyrus x bretschneideri] Length = 345 Score = 118 bits (295), Expect = 2e-24 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMKG GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKGCGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_008381571.1| PREDICTED: transcription factor TCP4-like [Malus domestica] Length = 349 Score = 118 bits (295), Expect = 2e-24 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMKG GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKGCGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_014522077.1| PREDICTED: transcription factor TCP4-like [Vigna radiata var. radiata] gi|951057800|ref|XP_014522078.1| PREDICTED: transcription factor TCP4-like [Vigna radiata var. radiata] gi|951057803|ref|XP_014522079.1| PREDICTED: transcription factor TCP4-like [Vigna radiata var. radiata] Length = 347 Score = 116 bits (291), Expect = 6e-24 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >gb|KOM43760.1| hypothetical protein LR48_Vigan05g136500 [Vigna angularis] Length = 347 Score = 116 bits (291), Expect = 6e-24 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_011002677.1| PREDICTED: transcription factor TCP4-like [Populus euphratica] Length = 346 Score = 116 bits (291), Expect = 6e-24 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEI+QVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTAGEIIQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_002325583.1| hypothetical protein POPTR_0019s12110g [Populus trichocarpa] gi|222862458|gb|EEE99964.1| hypothetical protein POPTR_0019s12110g [Populus trichocarpa] Length = 346 Score = 116 bits (291), Expect = 6e-24 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEI+QVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTAGEIIQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_007149767.1| hypothetical protein PHAVU_005G097200g [Phaseolus vulgaris] gi|561023031|gb|ESW21761.1| hypothetical protein PHAVU_005G097200g [Phaseolus vulgaris] Length = 330 Score = 116 bits (291), Expect = 6e-24 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_004487176.1| PREDICTED: transcription factor TCP4-like [Cicer arietinum] gi|502082469|ref|XP_004487177.1| PREDICTED: transcription factor TCP4-like [Cicer arietinum] gi|502082473|ref|XP_004487178.1| PREDICTED: transcription factor TCP4-like [Cicer arietinum] gi|502082476|ref|XP_004487179.1| PREDICTED: transcription factor TCP4-like [Cicer arietinum] gi|502082479|ref|XP_004487180.1| PREDICTED: transcription factor TCP4-like [Cicer arietinum] Length = 339 Score = 116 bits (291), Expect = 6e-24 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_003543311.1| PREDICTED: transcription factor TCP4-like isoform X1 [Glycine max] gi|571501618|ref|XP_006594827.1| PREDICTED: transcription factor TCP4-like isoform X2 [Glycine max] gi|734413234|gb|KHN36679.1| Transcription factor TCP4 [Glycine soja] gi|947073416|gb|KRH22307.1| hypothetical protein GLYMA_13G292500 [Glycine max] gi|947073417|gb|KRH22308.1| hypothetical protein GLYMA_13G292500 [Glycine max] gi|947073418|gb|KRH22309.1| hypothetical protein GLYMA_13G292500 [Glycine max] Length = 344 Score = 116 bits (291), Expect = 6e-24 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >gb|ACU20384.1| unknown [Glycine max] Length = 112 Score = 116 bits (291), Expect = 6e-24 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_002525139.1| transcription factor, putative [Ricinus communis] gi|223535598|gb|EEF37266.1| transcription factor, putative [Ricinus communis] Length = 349 Score = 115 bits (289), Expect = 1e-23 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 286 MKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MKGS GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MKGSGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 58 >gb|KHN27924.1| Transcription factor TCP4 [Glycine soja] Length = 343 Score = 115 bits (288), Expect = 1e-23 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAI+FYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIEFYDVQDRLG 60 >ref|XP_004303161.1| PREDICTED: transcription factor TCP4-like [Fragaria vesca subsp. vesca] Length = 366 Score = 115 bits (288), Expect = 1e-23 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSVGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_003540389.1| PREDICTED: transcription factor TCP4-like [Glycine max] gi|947078177|gb|KRH27017.1| hypothetical protein GLYMA_12G208800 [Glycine max] Length = 343 Score = 115 bits (288), Expect = 1e-23 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVRSTGRKDRHSKVYT+KGPRDRRVRLSAHTAI+FYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSKVYTAKGPRDRRVRLSAHTAIEFYDVQDRLG 60 >ref|XP_013465197.1| TCP family transcription factor [Medicago truncatula] gi|657399845|gb|KEH39232.1| TCP family transcription factor [Medicago truncatula] Length = 329 Score = 115 bits (288), Expect = 1e-23 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGMK + GEIVQVQGGHIVR+TGRKDRHSKVYT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMKSTGGEIVQVQGGHIVRATGRKDRHSKVYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_009354282.1| PREDICTED: transcription factor TCP4-like [Pyrus x bretschneideri] Length = 351 Score = 115 bits (287), Expect = 2e-23 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGM+G GEIV+VQGGHIVRSTGRKDRHSK+YT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMEGCGGEIVEVQGGHIVRSTGRKDRHSKIYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60 >ref|XP_008342868.1| PREDICTED: transcription factor TCP4-like [Malus domestica] Length = 354 Score = 115 bits (287), Expect = 2e-23 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 280 MGMKGSEGEIVQVQGGHIVRSTGRKDRHSKVYTSKGPRDRRVRLSAHTAIQFYDVQDRLG 459 MGM+G GEIV+VQGGHIVRSTGRKDRHSK+YT+KGPRDRRVRLSAHTAIQFYDVQDRLG Sbjct: 1 MGMEGCGGEIVEVQGGHIVRSTGRKDRHSKIYTAKGPRDRRVRLSAHTAIQFYDVQDRLG 60