BLASTX nr result
ID: Zanthoxylum22_contig00012307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00012307 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009787045.1| PREDICTED: uncharacterized protein LOC104235... 57 7e-06 ref|XP_009793836.1| PREDICTED: uncharacterized protein LOC104240... 57 7e-06 >ref|XP_009787045.1| PREDICTED: uncharacterized protein LOC104235067 [Nicotiana sylvestris] Length = 344 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/70 (38%), Positives = 42/70 (60%) Frame = +1 Query: 94 LDDSNFVSF*KDDENSLLRQHISPLIAQAICLVISWYYLYGMQEENNKSQIAHELREEGV 273 +DD N + NS + + +S L A A CLV+ W++ Y + EN++ I H+LR EG Sbjct: 1 MDDRN------NQNNSQISRQLSSLAAYAACLVVIWFWNYACEIENDRRTITHDLRIEGE 54 Query: 274 KIRDKLMQYL 303 ++R +LM YL Sbjct: 55 RVRSELMSYL 64 >ref|XP_009793836.1| PREDICTED: uncharacterized protein LOC104240661 [Nicotiana sylvestris] Length = 453 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/70 (38%), Positives = 42/70 (60%) Frame = +1 Query: 94 LDDSNFVSF*KDDENSLLRQHISPLIAQAICLVISWYYLYGMQEENNKSQIAHELREEGV 273 +DD N + NS + + +S L A A CLV+ W++ Y + EN++ I H+LR EG Sbjct: 1 MDDRN------NQNNSQISRQLSSLAAYAACLVVIWFWNYACEIENDRRTITHDLRIEGE 54 Query: 274 KIRDKLMQYL 303 ++R +LM YL Sbjct: 55 RVRSELMSYL 64