BLASTX nr result
ID: Zanthoxylum22_contig00011722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00011722 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422794.1| hypothetical protein CICLE_v10029096mg [Citr... 58 2e-06 >ref|XP_006422794.1| hypothetical protein CICLE_v10029096mg [Citrus clementina] gi|557524728|gb|ESR36034.1| hypothetical protein CICLE_v10029096mg [Citrus clementina] Length = 259 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -3 Query: 405 ASSSSPSRLLHGIKKVLIVKRKNGENTGNT-DKVIIITRKPAMKN 274 ASS SPS LH KKVL+V+R +G++ GN+ DK+IIITRKP MKN Sbjct: 215 ASSPSPSSFLHKTKKVLVVRRNSGQDRGNSGDKIIIITRKPPMKN 259