BLASTX nr result
ID: Zanthoxylum22_contig00011617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00011617 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO64417.1| hypothetical protein CISIN_1g031298mg [Citrus sin... 59 2e-06 ref|XP_006436871.1| hypothetical protein CICLE_v10032943mg [Citr... 59 2e-06 >gb|KDO64417.1| hypothetical protein CISIN_1g031298mg [Citrus sinensis] Length = 162 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 320 EQIVVTTYDGMHTHPIGKLTDSFDQILLKA 231 E+IVVTTY+G+HTHPIGK+TDSF+QILLKA Sbjct: 129 EEIVVTTYEGLHTHPIGKITDSFEQILLKA 158 >ref|XP_006436871.1| hypothetical protein CICLE_v10032943mg [Citrus clementina] gi|568880662|ref|XP_006493229.1| PREDICTED: probable WRKY transcription factor 75-like [Citrus sinensis] gi|557539067|gb|ESR50111.1| hypothetical protein CICLE_v10032943mg [Citrus clementina] Length = 162 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 320 EQIVVTTYDGMHTHPIGKLTDSFDQILLKA 231 E+IVVTTY+G+HTHPIGK+TDSF+QILLKA Sbjct: 129 EEIVVTTYEGLHTHPIGKITDSFEQILLKA 158