BLASTX nr result
ID: Zanthoxylum22_contig00011607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00011607 (254 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8 [Vitis... 65 2e-08 emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera] 65 2e-08 ref|XP_011087815.1| PREDICTED: tubby-like F-box protein 8 [Sesam... 65 2e-08 ref|XP_014518830.1| PREDICTED: tubby-like F-box protein 8 [Vigna... 64 4e-08 gb|KOM54026.1| hypothetical protein LR48_Vigan09g268500 [Vigna a... 64 4e-08 ref|XP_009351377.1| PREDICTED: tubby-like F-box protein 8 [Pyrus... 64 4e-08 ref|XP_008381822.1| PREDICTED: tubby-like F-box protein 8 [Malus... 64 4e-08 ref|XP_008237579.1| PREDICTED: tubby-like F-box protein 8 [Prunu... 64 4e-08 ref|XP_006597337.1| PREDICTED: tubby-like F-box protein 8-like i... 64 4e-08 ref|XP_007041585.1| Tubby like protein 10 isoform 1 [Theobroma c... 64 4e-08 ref|XP_004290516.1| PREDICTED: tubby-like F-box protein 8 [Fraga... 64 4e-08 ref|XP_007201025.1| hypothetical protein PRUPE_ppa006121mg [Prun... 64 4e-08 ref|XP_003531569.1| PREDICTED: tubby-like F-box protein 8-like i... 64 4e-08 ref|NP_001280941.1| tubby-like F-box protein 8 [Malus domestica]... 64 4e-08 ref|XP_012480545.1| PREDICTED: tubby-like F-box protein 8 [Gossy... 64 6e-08 ref|XP_012467678.1| PREDICTED: tubby-like F-box protein 8 [Gossy... 64 6e-08 gb|KHG16429.1| Tubby-like F-box protein 8 [Gossypium arboreum] 64 6e-08 ref|XP_009416896.1| PREDICTED: tubby-like F-box protein 8 [Musa ... 63 7e-08 ref|XP_002524285.1| phosphoric diester hydrolase, putative [Rici... 63 7e-08 ref|NP_001280861.1| tubby-like F-box protein 8 [Malus domestica]... 63 7e-08 >ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] gi|731430681|ref|XP_010665127.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] gi|731430683|ref|XP_010665128.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] gi|731430685|ref|XP_010665129.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] Length = 425 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR FDVRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGK 33 >emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera] Length = 380 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR FDVRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGK 33 >ref|XP_011087815.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum] gi|747081086|ref|XP_011087816.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum] gi|747081088|ref|XP_011087817.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum] gi|747081090|ref|XP_011087818.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum] Length = 425 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSI RD+R+SFGSLSRR FDVRLPGHHRGK Sbjct: 1 MSFRSIARDIRDSFGSLSRRSFDVRLPGHHRGK 33 >ref|XP_014518830.1| PREDICTED: tubby-like F-box protein 8 [Vigna radiata var. radiata] Length = 427 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGK 33 >gb|KOM54026.1| hypothetical protein LR48_Vigan09g268500 [Vigna angularis] Length = 427 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGK 33 >ref|XP_009351377.1| PREDICTED: tubby-like F-box protein 8 [Pyrus x bretschneideri] Length = 426 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR F+VRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGK 33 >ref|XP_008381822.1| PREDICTED: tubby-like F-box protein 8 [Malus domestica] Length = 426 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR F+VRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGK 33 >ref|XP_008237579.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume] Length = 426 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR F+VRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGK 33 >ref|XP_006597337.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Glycine max] gi|571516003|ref|XP_006597338.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Glycine max] gi|734405682|gb|KHN33484.1| Tubby-like F-box protein 8 [Glycine soja] gi|947061215|gb|KRH10476.1| hypothetical protein GLYMA_15G049500 [Glycine max] Length = 427 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGK 33 >ref|XP_007041585.1| Tubby like protein 10 isoform 1 [Theobroma cacao] gi|590683386|ref|XP_007041586.1| Tubby like protein 10 isoform 1 [Theobroma cacao] gi|508705520|gb|EOX97416.1| Tubby like protein 10 isoform 1 [Theobroma cacao] gi|508705521|gb|EOX97417.1| Tubby like protein 10 isoform 1 [Theobroma cacao] Length = 425 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGK 33 >ref|XP_004290516.1| PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] gi|764533036|ref|XP_011458506.1| PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] Length = 429 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR F+VRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGK 33 >ref|XP_007201025.1| hypothetical protein PRUPE_ppa006121mg [Prunus persica] gi|462396425|gb|EMJ02224.1| hypothetical protein PRUPE_ppa006121mg [Prunus persica] Length = 426 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR F+VRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGK 33 >ref|XP_003531569.1| PREDICTED: tubby-like F-box protein 8-like isoform X1 [Glycine max] gi|571471981|ref|XP_006585459.1| PREDICTED: tubby-like F-box protein 8-like isoform X2 [Glycine max] gi|571471983|ref|XP_006585460.1| PREDICTED: tubby-like F-box protein 8-like isoform X3 [Glycine max] gi|571471985|ref|XP_006585461.1| PREDICTED: tubby-like F-box protein 8-like isoform X4 [Glycine max] gi|571471987|ref|XP_006585462.1| PREDICTED: tubby-like F-box protein 8-like isoform X5 [Glycine max] gi|571471990|ref|XP_006585463.1| PREDICTED: tubby-like F-box protein 8-like isoform X6 [Glycine max] gi|734390420|gb|KHN26708.1| Tubby-like F-box protein 8 [Glycine soja] gi|947095379|gb|KRH43964.1| hypothetical protein GLYMA_08G183100 [Glycine max] Length = 427 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGK 33 >ref|NP_001280941.1| tubby-like F-box protein 8 [Malus domestica] gi|302399095|gb|ADL36842.1| TLP domain class transcription factor [Malus domestica] Length = 426 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRR F+VRLPGHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGK 33 >ref|XP_012480545.1| PREDICTED: tubby-like F-box protein 8 [Gossypium raimondii] gi|763765495|gb|KJB32749.1| hypothetical protein B456_005G259600 [Gossypium raimondii] gi|763765496|gb|KJB32750.1| hypothetical protein B456_005G259600 [Gossypium raimondii] Length = 425 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLMGHHRGK 33 >ref|XP_012467678.1| PREDICTED: tubby-like F-box protein 8 [Gossypium raimondii] gi|823135836|ref|XP_012467679.1| PREDICTED: tubby-like F-box protein 8 [Gossypium raimondii] gi|763748553|gb|KJB15992.1| hypothetical protein B456_002G207100 [Gossypium raimondii] gi|763748554|gb|KJB15993.1| hypothetical protein B456_002G207100 [Gossypium raimondii] gi|763748555|gb|KJB15994.1| hypothetical protein B456_002G207100 [Gossypium raimondii] Length = 421 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLVGHHRGK 33 >gb|KHG16429.1| Tubby-like F-box protein 8 [Gossypium arboreum] Length = 421 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRR FDVRL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLVGHHRGK 33 >ref|XP_009416896.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. malaccensis] gi|695057267|ref|XP_009416897.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. malaccensis] Length = 432 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+SFGSLSRRGF+ RL GHHRGK Sbjct: 1 MSFRSIVRDVRDSFGSLSRRGFEARLSGHHRGK 33 >ref|XP_002524285.1| phosphoric diester hydrolase, putative [Ricinus communis] gi|223536376|gb|EEF38025.1| phosphoric diester hydrolase, putative [Ricinus communis] Length = 424 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRD+R+ FGSLSRR FD+RLPGHHRGK Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFDLRLPGHHRGK 33 >ref|NP_001280861.1| tubby-like F-box protein 8 [Malus domestica] gi|302399103|gb|ADL36846.1| TLP domain class transcription factor [Malus domestica] Length = 424 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 MSFRSIVRDVRESFGSLSRRGFDVRLPGHHRGK 3 MSFRSIVRDVR+ FGSLSRRGF+VRL GHHRGK Sbjct: 1 MSFRSIVRDVRDGFGSLSRRGFEVRLTGHHRGK 33