BLASTX nr result
ID: Zanthoxylum22_contig00009187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00009187 (909 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006429064.1| hypothetical protein CICLE_v10012502mg [Citr... 62 5e-07 ref|XP_009769040.1| PREDICTED: uncharacterized protein LOC104219... 59 7e-06 >ref|XP_006429064.1| hypothetical protein CICLE_v10012502mg [Citrus clementina] gi|568854356|ref|XP_006480795.1| PREDICTED: uncharacterized protein LOC102610082 [Citrus sinensis] gi|557531121|gb|ESR42304.1| hypothetical protein CICLE_v10012502mg [Citrus clementina] gi|641828020|gb|KDO47186.1| hypothetical protein CISIN_1g024875mg [Citrus sinensis] gi|641828021|gb|KDO47187.1| hypothetical protein CISIN_1g024875mg [Citrus sinensis] Length = 261 Score = 62.4 bits (150), Expect = 5e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 97 TSLKLVSAMKGSREKQGASPRKLNVKWAPDVY 2 T LKLVSAMKGSRE+QGASPRKL+VKWAPDVY Sbjct: 121 TPLKLVSAMKGSRERQGASPRKLSVKWAPDVY 152 >ref|XP_009769040.1| PREDICTED: uncharacterized protein LOC104219970 [Nicotiana sylvestris] Length = 286 Score = 58.5 bits (140), Expect = 7e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 TSLKLVSAMKGSREKQGASPRKLNVKWAPDVY 2 T+LKLVSA+KGSREKQG SPRKL+V WAPDVY Sbjct: 132 TALKLVSAIKGSREKQGKSPRKLSVTWAPDVY 163