BLASTX nr result
ID: Zanthoxylum22_contig00008537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00008537 (580 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285566.1| PREDICTED: small acidic protein 1 [Vitis vin... 60 1e-06 ref|XP_006493997.1| PREDICTED: small acidic protein 1-like [Citr... 57 5e-06 >ref|XP_002285566.1| PREDICTED: small acidic protein 1 [Vitis vinifera] Length = 83 Score = 59.7 bits (143), Expect = 1e-06 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = -3 Query: 458 ERSMRPXXXXXXXXXXXXGASVAMDVDDVDPLEIFGEGVISIDNKLA 318 +R MRP GA+VAMDVDDVDPLEIFGEGVIS+DNKLA Sbjct: 19 KREMRPTPMEYYAELDDQGATVAMDVDDVDPLEIFGEGVISVDNKLA 65 >ref|XP_006493997.1| PREDICTED: small acidic protein 1-like [Citrus sinensis] Length = 62 Score = 57.4 bits (137), Expect = 5e-06 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -3 Query: 449 MRPXXXXXXXXXXXXGASVAMDVDDVDPLEIFGEGVISIDNKLA 318 MRP GA+VAMDVDDVDPLEIFGEG+ISIDNKLA Sbjct: 1 MRPMQMEFFGDMEDQGATVAMDVDDVDPLEIFGEGIISIDNKLA 44