BLASTX nr result
ID: Zanthoxylum22_contig00008496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00008496 (478 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097728.1| PREDICTED: calcineurin B-like protein 3 isof... 118 1e-24 ref|XP_011097725.1| PREDICTED: calcineurin B-like protein 3 isof... 118 1e-24 gb|KDO59210.1| hypothetical protein CISIN_1g027336mg [Citrus sin... 118 1e-24 ref|XP_012841833.1| PREDICTED: calcineurin B-like protein 3 [Ery... 118 1e-24 ref|XP_006452662.1| hypothetical protein CICLE_v10009412mg [Citr... 118 1e-24 ref|XP_009591409.1| PREDICTED: calcineurin B-like protein 3 [Nic... 117 3e-24 ref|XP_008803176.1| PREDICTED: calcineurin B-like protein 3 [Pho... 117 3e-24 emb|CDP13681.1| unnamed protein product [Coffea canephora] 117 3e-24 ref|XP_006346111.1| PREDICTED: calcineurin B-like protein 3-like... 117 3e-24 ref|NP_001239046.1| calcineurin B-like 2 [Solanum lycopersicum] ... 117 3e-24 ref|XP_013685429.1| PREDICTED: calcineurin B-like protein 2 [Bra... 117 4e-24 ref|XP_013625623.1| PREDICTED: calcineurin B-like protein 2 isof... 117 4e-24 ref|XP_010443239.1| PREDICTED: calcineurin B-like protein 2 [Cam... 117 4e-24 ref|XP_010450506.1| PREDICTED: calcineurin B-like protein 2 [Cam... 117 4e-24 ref|XP_009763342.1| PREDICTED: calcineurin B-like protein 3 isof... 117 4e-24 ref|XP_009132343.1| PREDICTED: calcineurin B-like protein 2 [Bra... 117 4e-24 ref|XP_013625624.1| PREDICTED: calcineurin B-like protein 2 isof... 117 4e-24 ref|XP_009126971.1| PREDICTED: calcineurin B-like protein 2 [Bra... 117 4e-24 ref|NP_200410.1| calcineurin B-like protein 2 [Arabidopsis thali... 117 4e-24 ref|NP_001302771.1| calcineurin B-like protein 2 [Brassica napus... 117 4e-24 >ref|XP_011097728.1| PREDICTED: calcineurin B-like protein 3 isoform X2 [Sesamum indicum] Length = 224 Score = 118 bits (296), Expect = 1e-24 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 169 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 224 >ref|XP_011097725.1| PREDICTED: calcineurin B-like protein 3 isoform X1 [Sesamum indicum] gi|747099351|ref|XP_011097726.1| PREDICTED: calcineurin B-like protein 3 isoform X1 [Sesamum indicum] Length = 225 Score = 118 bits (296), Expect = 1e-24 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 170 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 225 >gb|KDO59210.1| hypothetical protein CISIN_1g027336mg [Citrus sinensis] gi|641840289|gb|KDO59211.1| hypothetical protein CISIN_1g027336mg [Citrus sinensis] gi|641840290|gb|KDO59212.1| hypothetical protein CISIN_1g027336mg [Citrus sinensis] Length = 224 Score = 118 bits (296), Expect = 1e-24 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 169 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 224 >ref|XP_012841833.1| PREDICTED: calcineurin B-like protein 3 [Erythranthe guttatus] gi|604328056|gb|EYU33724.1| hypothetical protein MIMGU_mgv1a013314mg [Erythranthe guttata] Length = 224 Score = 118 bits (296), Expect = 1e-24 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 169 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 224 >ref|XP_006452662.1| hypothetical protein CICLE_v10009412mg [Citrus clementina] gi|567921314|ref|XP_006452663.1| hypothetical protein CICLE_v10009412mg [Citrus clementina] gi|568841750|ref|XP_006474819.1| PREDICTED: calcineurin B-like protein 3-like isoform X1 [Citrus sinensis] gi|568841752|ref|XP_006474820.1| PREDICTED: calcineurin B-like protein 3-like isoform X2 [Citrus sinensis] gi|557555888|gb|ESR65902.1| hypothetical protein CICLE_v10009412mg [Citrus clementina] gi|557555889|gb|ESR65903.1| hypothetical protein CICLE_v10009412mg [Citrus clementina] Length = 223 Score = 118 bits (296), Expect = 1e-24 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 168 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 223 >ref|XP_009591409.1| PREDICTED: calcineurin B-like protein 3 [Nicotiana tomentosiformis] gi|698475477|ref|XP_009785110.1| PREDICTED: calcineurin B-like protein 3 [Nicotiana sylvestris] Length = 219 Score = 117 bits (293), Expect = 3e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWR+LVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 164 TFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 219 >ref|XP_008803176.1| PREDICTED: calcineurin B-like protein 3 [Phoenix dactylifera] gi|672166496|ref|XP_008803178.1| PREDICTED: calcineurin B-like protein 3 [Phoenix dactylifera] Length = 226 Score = 117 bits (293), Expect = 3e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRV+DT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVDDT 226 >emb|CDP13681.1| unnamed protein product [Coffea canephora] Length = 226 Score = 117 bits (293), Expect = 3e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDG+IDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 171 TFEEADTKHDGRIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 226 >ref|XP_006346111.1| PREDICTED: calcineurin B-like protein 3-like [Solanum tuberosum] Length = 219 Score = 117 bits (293), Expect = 3e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWR+LVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 164 TFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 219 >ref|NP_001239046.1| calcineurin B-like 2 [Solanum lycopersicum] gi|723717651|ref|XP_010324187.1| PREDICTED: calcineurin B-like 2 isoform X1 [Solanum lycopersicum] gi|353523404|dbj|BAL04562.1| calcineurin B-like molecule [Solanum lycopersicum] Length = 219 Score = 117 bits (293), Expect = 3e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWR+LVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 164 TFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 219 >ref|XP_013685429.1| PREDICTED: calcineurin B-like protein 2 [Brassica napus] Length = 226 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226 >ref|XP_013625623.1| PREDICTED: calcineurin B-like protein 2 isoform X1 [Brassica oleracea var. oleracea] gi|923784354|ref|XP_013682724.1| PREDICTED: calcineurin B-like protein 2 isoform X1 [Brassica napus] Length = 249 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 194 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 249 >ref|XP_010443239.1| PREDICTED: calcineurin B-like protein 2 [Camelina sativa] Length = 226 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226 >ref|XP_010450506.1| PREDICTED: calcineurin B-like protein 2 [Camelina sativa] Length = 226 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226 >ref|XP_009763342.1| PREDICTED: calcineurin B-like protein 3 isoform X1 [Nicotiana sylvestris] gi|724090752|gb|AIY25502.1| CBL2 protein [Nicotiana sylvestris] Length = 224 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVL+HPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 169 TFEEADTKHDGKIDKEEWRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 224 >ref|XP_009132343.1| PREDICTED: calcineurin B-like protein 2 [Brassica rapa] Length = 238 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 183 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 238 >ref|XP_013625624.1| PREDICTED: calcineurin B-like protein 2 isoform X2 [Brassica oleracea var. oleracea] gi|923784357|ref|XP_013682725.1| PREDICTED: calcineurin B-like protein 2 isoform X2 [Brassica napus] gi|674921358|emb|CDY11963.1| BnaC03g13890D [Brassica napus] Length = 238 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 183 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 238 >ref|XP_009126971.1| PREDICTED: calcineurin B-like protein 2 [Brassica rapa] gi|922429705|ref|XP_013620906.1| PREDICTED: calcineurin B-like protein 2 [Brassica oleracea var. oleracea] gi|922429707|ref|XP_013620907.1| PREDICTED: calcineurin B-like protein 2 [Brassica oleracea var. oleracea] gi|923757352|ref|XP_013676164.1| PREDICTED: calcineurin B-like protein 2 [Brassica napus] gi|923757356|ref|XP_013676165.1| PREDICTED: calcineurin B-like protein 2 [Brassica napus] gi|674869895|emb|CDY64981.1| BnaA02g35430D [Brassica napus] gi|674926725|emb|CDY06547.1| BnaC02g12710D [Brassica napus] Length = 226 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226 >ref|NP_200410.1| calcineurin B-like protein 2 [Arabidopsis thaliana] gi|56748807|sp|Q8LAS7.2|CNBL2_ARATH RecName: Full=Calcineurin B-like protein 2; AltName: Full=SOS3-like calcium-binding protein 1 gi|168177188|pdb|2ZFD|A Chain A, The Crystal Structure Of Plant Specific Calcium Binding Protein Atcbl2 In Complex With The Regulatory Domain Of Atcipk14 gi|3309084|gb|AAC26009.1| calcineurin B-like protein 2 [Arabidopsis thaliana] gi|9758619|dbj|BAB09281.1| calcineurin B-like protein 2 [Arabidopsis thaliana] gi|15450407|gb|AAK96497.1| AT5g55990/MDA7_3 [Arabidopsis thaliana] gi|22655046|gb|AAM98114.1| At5g55990/MDA7_3 [Arabidopsis thaliana] gi|332009324|gb|AED96707.1| calcineurin B-like protein 2 [Arabidopsis thaliana] Length = 226 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226 >ref|NP_001302771.1| calcineurin B-like protein 2 [Brassica napus] gi|430217531|gb|AGA37194.1| calcineurin B-like 2.1 [Brassica napus] Length = 226 Score = 117 bits (292), Expect = 4e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 478 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 311 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226