BLASTX nr result
ID: Zanthoxylum22_contig00007650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00007650 (552 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006490254.1| PREDICTED: clp protease-related protein At4g... 65 2e-08 ref|XP_006421758.1| hypothetical protein CICLE_v10005783mg [Citr... 65 2e-08 ref|XP_012090389.1| PREDICTED: clp protease-related protein At4g... 64 4e-08 ref|XP_007038471.1| Double Clp-N motif protein [Theobroma cacao]... 59 1e-06 ref|XP_011030186.1| PREDICTED: clp protease-related protein At4g... 56 1e-05 ref|XP_011029987.1| PREDICTED: clp protease-related protein At4g... 56 1e-05 gb|KHG17426.1| hypothetical protein F383_21069 [Gossypium arboreum] 56 1e-05 ref|XP_006587382.1| PREDICTED: clp protease-related protein At4g... 56 1e-05 ref|XP_003534040.1| PREDICTED: clp protease-related protein At4g... 56 1e-05 >ref|XP_006490254.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Citrus sinensis] gi|641846498|gb|KDO65381.1| hypothetical protein CISIN_1g026790mg [Citrus sinensis] Length = 233 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 550 IWSEKESAGRMVLAILGFNDEKAKEISKSINEDTVLT 440 IWSEKESAG +LA LGFNDEKAKEI+KSINEDT+L+ Sbjct: 195 IWSEKESAGHKILATLGFNDEKAKEIAKSINEDTILS 231 >ref|XP_006421758.1| hypothetical protein CICLE_v10005783mg [Citrus clementina] gi|557523631|gb|ESR34998.1| hypothetical protein CICLE_v10005783mg [Citrus clementina] Length = 233 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 550 IWSEKESAGRMVLAILGFNDEKAKEISKSINEDTVLT 440 IWSEKESAG +LA LGFNDEKAKEI+KSINEDT+L+ Sbjct: 195 IWSEKESAGHKILATLGFNDEKAKEIAKSINEDTILS 231 >ref|XP_012090389.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic [Jatropha curcas] gi|643706251|gb|KDP22383.1| hypothetical protein JCGZ_26214 [Jatropha curcas] Length = 227 Score = 64.3 bits (155), Expect = 4e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 550 IWSEKESAGRMVLAILGFNDEKAKEISKSINEDTVLTSE 434 IWSEKESAG +LA LGFNDEKAKEI+KS+NED VL+S+ Sbjct: 189 IWSEKESAGHKILATLGFNDEKAKEIAKSMNEDVVLSSK 227 >ref|XP_007038471.1| Double Clp-N motif protein [Theobroma cacao] gi|508775716|gb|EOY22972.1| Double Clp-N motif protein [Theobroma cacao] Length = 230 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 550 IWSEKESAGRMVLAILGFNDEKAKEISKSINEDTVL 443 IWSEKESAG +LA LGFNDEKAKE++K INED VL Sbjct: 192 IWSEKESAGYKILATLGFNDEKAKELTKYINEDIVL 227 >ref|XP_011030186.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Populus euphratica] Length = 187 Score = 56.2 bits (134), Expect = 1e-05 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 547 WSEKESAGRMVLAILGFNDEKAKEISKSINEDTVLT 440 WSEKESAGR +L LGFND+KAKE+++S+NED L+ Sbjct: 150 WSEKESAGRKILETLGFNDDKAKEVAESMNEDVALS 185 >ref|XP_011029987.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Populus euphratica] Length = 229 Score = 56.2 bits (134), Expect = 1e-05 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 547 WSEKESAGRMVLAILGFNDEKAKEISKSINEDTVLT 440 WSEKESAGR +L LGFND+KAKE+++S+NED L+ Sbjct: 192 WSEKESAGRKILETLGFNDDKAKEVAESMNEDVALS 227 >gb|KHG17426.1| hypothetical protein F383_21069 [Gossypium arboreum] Length = 230 Score = 56.2 bits (134), Expect = 1e-05 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 550 IWSEKESAGRMVLAILGFNDEKAKEISKSINEDTVL 443 IWSEKESAG +LA GFNDEKAKE++K +N+D VL Sbjct: 192 IWSEKESAGHKILATFGFNDEKAKELAKFLNDDIVL 227 >ref|XP_006587382.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X2 [Glycine max] Length = 253 Score = 56.2 bits (134), Expect = 1e-05 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 550 IWSEKESAGRMVLAILGFNDEKAKEISKSINEDTVLT 440 IWS+KESAG+ +LA LGFNDEKAKE+SKSI+ D L+ Sbjct: 212 IWSQKESAGQQILATLGFNDEKAKELSKSIDGDVDLS 248 >ref|XP_003534040.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X1 [Glycine max] gi|734392920|gb|KHN27848.1| Clp protease-related protein, chloroplastic [Glycine soja] gi|947090052|gb|KRH38717.1| hypothetical protein GLYMA_09G153300 [Glycine max] Length = 252 Score = 56.2 bits (134), Expect = 1e-05 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 550 IWSEKESAGRMVLAILGFNDEKAKEISKSINEDTVLT 440 IWS+KESAG+ +LA LGFNDEKAKE+SKSI+ D L+ Sbjct: 211 IWSQKESAGQQILATLGFNDEKAKELSKSIDGDVDLS 247