BLASTX nr result
ID: Zanthoxylum22_contig00007487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00007487 (1766 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006439333.1| hypothetical protein CICLE_v10023024mg [Citr... 56 4e-06 >ref|XP_006439333.1| hypothetical protein CICLE_v10023024mg [Citrus clementina] gi|557541595|gb|ESR52573.1| hypothetical protein CICLE_v10023024mg [Citrus clementina] Length = 100 Score = 56.2 bits (134), Expect(2) = 4e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 1350 DMTASPKEHTNGQKICASLNLIGKTLHITF 1439 +MTASPKE TNGQKIC LNLIGKTLHITF Sbjct: 58 NMTASPKEPTNGQKICVPLNLIGKTLHITF 87 Score = 24.6 bits (52), Expect(2) = 4e-06 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 1268 LLYVYTHLHCXXXXXXXH 1321 LLYV THLHC H Sbjct: 30 LLYVCTHLHCIISSCSSH 47