BLASTX nr result
ID: Zanthoxylum22_contig00007146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00007146 (390 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013696645.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_013598917.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] 65 2e-08 ref|XP_010494948.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_010481350.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_010441489.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_010275481.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_010275480.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_010258750.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_009413275.1| PREDICTED: 50S ribosomal protein L19, chloro... 65 2e-08 ref|XP_009114289.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_009108335.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 65 2e-08 ref|XP_009101442.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 ref|XP_013655955.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 65 2e-08 emb|CDX77747.1| BnaC07g20010D [Brassica napus] 65 2e-08 ref|XP_013607076.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 emb|CDY33520.1| BnaA06g35530D [Brassica napus] 65 2e-08 ref|XP_013726272.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 65 2e-08 gb|KFK31392.1| hypothetical protein AALP_AA6G105900 [Arabis alpina] 65 2e-08 ref|XP_012070081.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 65 2e-08 >ref|XP_013696645.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like isoform X1 [Brassica napus] gi|923828322|ref|XP_013696646.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like isoform X2 [Brassica napus] Length = 216 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 185 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 216 >ref|XP_013598917.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic [Brassica oleracea var. oleracea] gi|923864429|ref|XP_013707606.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Brassica napus] Length = 219 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 188 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 219 >dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] Length = 286 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 255 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 286 >ref|XP_010494948.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Camelina sativa] Length = 228 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 197 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 228 >ref|XP_010481350.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic [Camelina sativa] Length = 228 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 197 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 228 >ref|XP_010441489.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Camelina sativa] Length = 229 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 198 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >ref|XP_010275481.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic isoform X2 [Nelumbo nucifera] Length = 237 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 206 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 237 >ref|XP_010275480.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic isoform X1 [Nelumbo nucifera] Length = 241 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 210 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 241 >ref|XP_010258750.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Nelumbo nucifera] Length = 243 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 212 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 243 >ref|XP_009413275.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 226 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 195 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 226 >ref|XP_009114289.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Brassica rapa] Length = 219 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 188 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 219 >ref|XP_009108335.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Brassica rapa] Length = 222 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 191 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 222 >ref|XP_009101442.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic [Brassica rapa] Length = 219 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 188 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 219 >ref|XP_013655955.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Brassica napus] gi|674957205|emb|CDX76564.1| BnaA08g08360D [Brassica napus] Length = 220 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 189 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 220 >emb|CDX77747.1| BnaC07g20010D [Brassica napus] Length = 219 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 188 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 219 >ref|XP_013607076.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Brassica oleracea var. oleracea] gi|923887168|ref|XP_013714911.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Brassica napus] gi|674907130|emb|CDY25981.1| BnaC09g20060D [Brassica napus] Length = 214 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 183 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 214 >emb|CDY33520.1| BnaA06g35530D [Brassica napus] Length = 219 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 188 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 219 >ref|XP_013726272.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Brassica napus] gi|674889241|emb|CDY43437.1| BnaAnng07090D [Brassica napus] Length = 218 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 187 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 218 >gb|KFK31392.1| hypothetical protein AALP_AA6G105900 [Arabis alpina] Length = 231 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 200 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 231 >ref|XP_012070081.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Jatropha curcas] gi|643732950|gb|KDP39939.1| hypothetical protein JCGZ_03470 [Jatropha curcas] Length = 247 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 390 NIKEIKVVTHRKVRRARLYYLRDKLPRLSTFK 295 NIKEIKVV+HRKVRRARLYYLRDKLPRLSTFK Sbjct: 216 NIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 247