BLASTX nr result
ID: Zanthoxylum22_contig00006821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00006821 (445 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511795.1| peroxisomal biogenesis factor, putative [Ric... 104 3e-20 ref|XP_011035325.1| PREDICTED: peroxisomal membrane protein 11D ... 103 7e-20 gb|KDO85999.1| hypothetical protein CISIN_1g024612mg [Citrus sin... 103 7e-20 gb|KDO85998.1| hypothetical protein CISIN_1g024612mg [Citrus sin... 103 7e-20 gb|KDO85993.1| hypothetical protein CISIN_1g024612mg [Citrus sin... 103 7e-20 ref|XP_006445153.1| hypothetical protein CICLE_v10022007mg [Citr... 103 7e-20 ref|XP_011023424.1| PREDICTED: peroxisomal membrane protein 11D ... 102 1e-19 ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Popu... 102 1e-19 ref|XP_002301325.1| peroxisomal biogenesis factor 11 family prot... 102 1e-19 ref|XP_002320762.1| peroxisomal biogenesis factor 11 family prot... 101 2e-19 ref|XP_010523724.1| PREDICTED: peroxisomal membrane protein 11D-... 100 3e-19 ref|XP_012083481.1| PREDICTED: peroxisomal membrane protein 11C ... 100 3e-19 ref|XP_006294921.1| hypothetical protein CARUB_v10023974mg [Caps... 100 4e-19 ref|XP_010053656.1| PREDICTED: peroxisomal membrane protein 11D-... 100 6e-19 gb|KCW77996.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus g... 100 6e-19 ref|XP_009761323.1| PREDICTED: peroxisomal membrane protein 11D-... 100 7e-19 ref|XP_011091593.1| PREDICTED: peroxisomal membrane protein 11C ... 99 1e-18 emb|CDP08886.1| unnamed protein product [Coffea canephora] 99 1e-18 ref|XP_006397755.1| hypothetical protein EUTSA_v10001566mg [Eutr... 99 1e-18 ref|XP_002880194.1| peroxisomal biogenesis factor 11 family prot... 99 1e-18 >ref|XP_002511795.1| peroxisomal biogenesis factor, putative [Ricinus communis] gi|223548975|gb|EEF50464.1| peroxisomal biogenesis factor, putative [Ricinus communis] Length = 235 Score = 104 bits (259), Expect = 3e-20 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAKL+KSNE SLAL+K+AMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ Sbjct: 169 QYRAKLQKSNERSLALVKAAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 224 >ref|XP_011035325.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] gi|743789112|ref|XP_011035333.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] gi|743789116|ref|XP_011035337.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] gi|743789120|ref|XP_011035345.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] Length = 235 Score = 103 bits (256), Expect = 7e-20 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFGFV+SLISCYQ Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQ 224 >gb|KDO85999.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis] Length = 240 Score = 103 bits (256), Expect = 7e-20 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QY+AKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 169 QYQAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 224 >gb|KDO85998.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis] Length = 232 Score = 103 bits (256), Expect = 7e-20 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QY+AKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 169 QYQAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 224 >gb|KDO85993.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis] Length = 265 Score = 103 bits (256), Expect = 7e-20 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QY+AKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 199 QYQAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 254 >ref|XP_006445153.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|567905332|ref|XP_006445154.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|567905334|ref|XP_006445155.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|568875864|ref|XP_006491010.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X1 [Citrus sinensis] gi|568875866|ref|XP_006491011.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X2 [Citrus sinensis] gi|568875868|ref|XP_006491012.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X3 [Citrus sinensis] gi|568875870|ref|XP_006491013.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X4 [Citrus sinensis] gi|557547415|gb|ESR58393.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|557547416|gb|ESR58394.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|557547417|gb|ESR58395.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|641867310|gb|KDO85994.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis] gi|641867311|gb|KDO85995.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis] gi|641867312|gb|KDO85996.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis] gi|641867313|gb|KDO85997.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis] Length = 235 Score = 103 bits (256), Expect = 7e-20 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QY+AKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 169 QYQAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 224 >ref|XP_011023424.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] gi|743829095|ref|XP_011023425.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] Length = 235 Score = 102 bits (253), Expect = 1e-19 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFG VTSLISCYQ Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGVVTSLISCYQ 224 >ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Populus trichocarpa] gi|550345090|gb|ERP64387.1| hypothetical protein POPTR_0002s15510g [Populus trichocarpa] Length = 180 Score = 102 bits (253), Expect = 1e-19 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFG VTSLISCYQ Sbjct: 114 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGVVTSLISCYQ 169 >ref|XP_002301325.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|118484040|gb|ABK93906.1| unknown [Populus trichocarpa] gi|222843051|gb|EEE80598.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] Length = 235 Score = 102 bits (253), Expect = 1e-19 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTGAFG VTSLISCYQ Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGVVTSLISCYQ 224 >ref|XP_002320762.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|566203052|ref|XP_006375324.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] gi|118489542|gb|ABK96573.1| unknown [Populus trichocarpa x Populus deltoides] gi|222861535|gb|EEE99077.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|550323695|gb|ERP53121.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] Length = 235 Score = 101 bits (252), Expect = 2e-19 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAKLKKSNE SLAL+KSAMDIVVAVGLLQLAPKKV PRVTG FGFV+SLISCYQ Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQ 224 >ref|XP_010523724.1| PREDICTED: peroxisomal membrane protein 11D-like [Tarenaya hassleriana] gi|729453412|ref|XP_010523725.1| PREDICTED: peroxisomal membrane protein 11D-like [Tarenaya hassleriana] Length = 235 Score = 100 bits (250), Expect = 3e-19 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAKL+KSNE +LALIKS MDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 169 QYRAKLQKSNERTLALIKSGMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 224 >ref|XP_012083481.1| PREDICTED: peroxisomal membrane protein 11C [Jatropha curcas] gi|802697204|ref|XP_012083482.1| PREDICTED: peroxisomal membrane protein 11C [Jatropha curcas] gi|802697208|ref|XP_012083483.1| PREDICTED: peroxisomal membrane protein 11C [Jatropha curcas] gi|643717063|gb|KDP28689.1| hypothetical protein JCGZ_14460 [Jatropha curcas] Length = 235 Score = 100 bits (250), Expect = 3e-19 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYR+KL+KSNE SLAL+K+AMDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 169 QYRSKLQKSNERSLALVKAAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 224 >ref|XP_006294921.1| hypothetical protein CARUB_v10023974mg [Capsella rubella] gi|482563629|gb|EOA27819.1| hypothetical protein CARUB_v10023974mg [Capsella rubella] Length = 236 Score = 100 bits (249), Expect = 4e-19 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 +YRAKLKKSNE SLALIKSAMDIVVA GLLQLAPKK+ PRVTGAFGF+TS+ISCYQ Sbjct: 170 EYRAKLKKSNERSLALIKSAMDIVVAAGLLQLAPKKITPRVTGAFGFITSVISCYQ 225 >ref|XP_010053656.1| PREDICTED: peroxisomal membrane protein 11D-like [Eucalyptus grandis] gi|702326526|ref|XP_010053657.1| PREDICTED: peroxisomal membrane protein 11D-like [Eucalyptus grandis] gi|629113037|gb|KCW77997.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis] gi|629113038|gb|KCW77998.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis] gi|629113039|gb|KCW77999.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis] Length = 235 Score = 100 bits (248), Expect = 6e-19 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAK+++SNE SLALIK+AMDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 169 QYRAKVRQSNERSLALIKAAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 224 >gb|KCW77996.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis] Length = 236 Score = 100 bits (248), Expect = 6e-19 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYRAK+++SNE SLALIK+AMDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 170 QYRAKVRQSNERSLALIKAAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 225 >ref|XP_009761323.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana sylvestris] gi|698528984|ref|XP_009761324.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana sylvestris] Length = 234 Score = 99.8 bits (247), Expect = 7e-19 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYR+KL+KSNE SLALIK+ MDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 168 QYRSKLQKSNERSLALIKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 223 >ref|XP_011091593.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum] gi|747044940|ref|XP_011091600.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum] gi|747044942|ref|XP_011091609.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum] gi|747044944|ref|XP_011091619.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum] Length = 235 Score = 99.4 bits (246), Expect = 1e-18 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYR+KLKKSNE SLAL+K+ MDIVVAVGLLQLAPKKV PRVTGAFGFV+SLISCYQ Sbjct: 169 QYRSKLKKSNERSLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQ 224 >emb|CDP08886.1| unnamed protein product [Coffea canephora] Length = 235 Score = 99.4 bits (246), Expect = 1e-18 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 QYR KL+KSNE SLALIK+ MDIVVAVGLLQLAPKKV PRVTGAFGFVTSLISCYQ Sbjct: 169 QYRVKLQKSNERSLALIKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQ 224 >ref|XP_006397755.1| hypothetical protein EUTSA_v10001566mg [Eutrema salsugineum] gi|557098828|gb|ESQ39208.1| hypothetical protein EUTSA_v10001566mg [Eutrema salsugineum] Length = 297 Score = 99.4 bits (246), Expect = 1e-18 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 +YRAKLKKSNE +LALIKSAMDIVVA GLLQLAPKK+ PRVTGAFGF TSLISCYQ Sbjct: 231 EYRAKLKKSNERTLALIKSAMDIVVAAGLLQLAPKKITPRVTGAFGFTTSLISCYQ 286 >ref|XP_002880194.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] gi|297326033|gb|EFH56453.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] Length = 236 Score = 99.4 bits (246), Expect = 1e-18 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 445 QYRAKLKKSNESSLALIKSAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQ 278 +YRAKLK+SNE SLALIKSAMDIVVA GLLQLAPKK+ PRVTGAFGF+TS+ISCYQ Sbjct: 170 EYRAKLKQSNERSLALIKSAMDIVVAAGLLQLAPKKITPRVTGAFGFITSIISCYQ 225