BLASTX nr result
ID: Zanthoxylum22_contig00006275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00006275 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433618.1| hypothetical protein CICLE_v10002925mg [Citr... 73 7e-11 gb|KDO81547.1| hypothetical protein CISIN_1g034453mg [Citrus sin... 72 2e-10 ref|XP_006433620.1| hypothetical protein CICLE_v10002925mg [Citr... 65 2e-08 emb|CBI19418.3| unnamed protein product [Vitis vinifera] 57 4e-06 ref|XP_007018533.1| Uncharacterized protein TCM_034727 [Theobrom... 56 9e-06 >ref|XP_006433618.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|567882121|ref|XP_006433619.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|557535740|gb|ESR46858.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|557535741|gb|ESR46859.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] Length = 94 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 109 MKTWDKMALPMRRLWNGVALRLGIRKSGLLRLRRDV 2 MK WDKMALPMRR+WNGVALRLGIRKSGLLRLRRDV Sbjct: 1 MKLWDKMALPMRRVWNGVALRLGIRKSGLLRLRRDV 36 >gb|KDO81547.1| hypothetical protein CISIN_1g034453mg [Citrus sinensis] gi|641862861|gb|KDO81548.1| hypothetical protein CISIN_1g034453mg [Citrus sinensis] Length = 94 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 109 MKTWDKMALPMRRLWNGVALRLGIRKSGLLRLRRDV 2 MK WDKMALPMRR+WNGVALRLGIRKSGLLRLR+DV Sbjct: 1 MKLWDKMALPMRRVWNGVALRLGIRKSGLLRLRQDV 36 >ref|XP_006433620.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|557535742|gb|ESR46860.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] Length = 104 Score = 65.1 bits (157), Expect = 2e-08 Identities = 34/46 (73%), Positives = 35/46 (76%), Gaps = 10/46 (21%) Frame = -2 Query: 109 MKTWDKMALPMRRLWNGVALRLGIRKS----------GLLRLRRDV 2 MK WDKMALPMRR+WNGVALRLGIRKS GLLRLRRDV Sbjct: 1 MKLWDKMALPMRRVWNGVALRLGIRKSGEFPLHPALNGLLRLRRDV 46 >emb|CBI19418.3| unnamed protein product [Vitis vinifera] Length = 91 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 109 MKTWDKMALPMRRLWNGVALRLGIRKSGLLRLRRDV 2 M+ WDKM PMR +WNGVA R GIRK+GLL+LR DV Sbjct: 1 MEWWDKMMFPMRTVWNGVAKRFGIRKTGLLKLRNDV 36 >ref|XP_007018533.1| Uncharacterized protein TCM_034727 [Theobroma cacao] gi|508723861|gb|EOY15758.1| Uncharacterized protein TCM_034727 [Theobroma cacao] Length = 174 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 109 MKTWDKMALPMRRLWNGVALRLGIRKSGLLRLRRDV 2 M +D+M +PMRR+W GVA RLG+RKSGLL+LR+DV Sbjct: 88 MHFFDRMTIPMRRVWTGVATRLGVRKSGLLKLRKDV 123