BLASTX nr result
ID: Zanthoxylum22_contig00006248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00006248 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO61949.1| hypothetical protein CISIN_1g0355061mg, partial [... 69 1e-09 ref|XP_006453238.1| hypothetical protein CICLE_v10008415mg [Citr... 69 1e-09 >gb|KDO61949.1| hypothetical protein CISIN_1g0355061mg, partial [Citrus sinensis] Length = 328 Score = 69.3 bits (168), Expect = 1e-09 Identities = 38/57 (66%), Positives = 44/57 (77%), Gaps = 5/57 (8%) Frame = -2 Query: 157 LFYSLPKPKSAPPFPSIPQPK--QQTHENPSPKTLISNNFDD---DEEELKKSTSNS 2 LF SLP+PKS+P F SIPQPK QQT++NP KTL SNNFDD +E+E KK TSNS Sbjct: 3 LFSSLPQPKSSPLFSSIPQPKQQQQTNKNPVSKTLTSNNFDDHDEEEKESKKPTSNS 59 >ref|XP_006453238.1| hypothetical protein CICLE_v10008415mg [Citrus clementina] gi|568840653|ref|XP_006474280.1| PREDICTED: suppressor protein SRP40-like [Citrus sinensis] gi|557556464|gb|ESR66478.1| hypothetical protein CICLE_v10008415mg [Citrus clementina] Length = 420 Score = 69.3 bits (168), Expect = 1e-09 Identities = 38/57 (66%), Positives = 44/57 (77%), Gaps = 5/57 (8%) Frame = -2 Query: 157 LFYSLPKPKSAPPFPSIPQPK--QQTHENPSPKTLISNNFDD---DEEELKKSTSNS 2 LF SLP+PKS+P F SIPQPK QQT++NP KTL SNNFDD +E+E KK TSNS Sbjct: 43 LFSSLPQPKSSPLFSSIPQPKQQQQTNKNPVSKTLTSNNFDDHDEEEKESKKPTSNS 99