BLASTX nr result
ID: Zanthoxylum22_contig00005334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00005334 (639 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006475026.1| PREDICTED: proline synthase co-transcribed b... 114 5e-34 ref|XP_006452430.1| hypothetical protein CICLE_v10009301mg [Citr... 114 5e-34 ref|XP_009361027.1| PREDICTED: proline synthase co-transcribed b... 97 3e-29 ref|XP_008364652.1| PREDICTED: proline synthase co-transcribed b... 97 3e-29 ref|XP_002518437.1| proline synthetase associated protein, putat... 99 9e-29 ref|XP_006383876.1| hypothetical protein POPTR_0004s00800g [Popu... 99 1e-28 ref|XP_003532139.1| PREDICTED: proline synthase co-transcribed b... 99 2e-28 ref|XP_012841976.1| PREDICTED: proline synthase co-transcribed b... 98 5e-28 ref|XP_004294414.1| PREDICTED: proline synthase co-transcribed b... 92 6e-28 ref|XP_006602187.1| PREDICTED: 1,4-alpha-glucan-branching enzyme... 99 1e-27 gb|KRG98709.1| hypothetical protein GLYMA_18G092500 [Glycine max] 99 1e-27 gb|KHN12521.1| Proline synthase co-transcribed bacterial like pr... 99 1e-27 ref|XP_010926179.1| PREDICTED: proline synthase co-transcribed b... 96 1e-27 ref|XP_004248334.1| PREDICTED: proline synthase co-transcribed b... 99 2e-27 ref|XP_011087040.1| PREDICTED: proline synthase co-transcribed b... 97 3e-27 ref|XP_009762484.1| PREDICTED: proline synthase co-transcribed b... 98 3e-27 gb|ABK22393.1| unknown [Picea sitchensis] 94 4e-27 ref|XP_006352515.1| PREDICTED: proline synthase co-transcribed b... 98 4e-27 ref|XP_008780848.1| PREDICTED: proline synthase co-transcribed b... 95 5e-27 ref|XP_009392906.1| PREDICTED: proline synthase co-transcribed b... 94 8e-27 >ref|XP_006475026.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Citrus sinensis] Length = 245 Score = 114 bits (284), Expect(2) = 5e-34 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIE+GSTSVRIGSTIFGPR+YAK Sbjct: 182 PENFRTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAK 241 Query: 347 K 345 K Sbjct: 242 K 242 Score = 58.2 bits (139), Expect(2) = 5e-34 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLDKAVSNLGR PLKVLVQVNTSGEE Sbjct: 112 KIANHLDKAVSNLGRKPLKVLVQVNTSGEE 141 >ref|XP_006452430.1| hypothetical protein CICLE_v10009301mg [Citrus clementina] gi|557555656|gb|ESR65670.1| hypothetical protein CICLE_v10009301mg [Citrus clementina] Length = 245 Score = 114 bits (284), Expect(2) = 5e-34 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIE+GSTSVRIGSTIFGPR+YAK Sbjct: 182 PENFRTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAK 241 Query: 347 K 345 K Sbjct: 242 K 242 Score = 58.2 bits (139), Expect(2) = 5e-34 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLDKAVSNLGR PLKVLVQVNTSGEE Sbjct: 112 KIANHLDKAVSNLGRKPLKVLVQVNTSGEE 141 >ref|XP_009361027.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Pyrus x bretschneideri] gi|694410090|ref|XP_009379653.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Pyrus x bretschneideri] Length = 245 Score = 96.7 bits (239), Expect(2) = 3e-29 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P L CR EVCKAL MAE+ CELSMGMSGDFEQAIE+GST+VRIGSTIFGPR+Y K Sbjct: 182 PENFRMLSKCRTEVCKALAMAEEHCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPK 241 Query: 347 K 345 K Sbjct: 242 K 242 Score = 59.3 bits (142), Expect(2) = 3e-29 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLD+AVSNLGRNPLKVLVQVNTSGEE Sbjct: 112 KIANHLDRAVSNLGRNPLKVLVQVNTSGEE 141 >ref|XP_008364652.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Malus domestica] Length = 245 Score = 96.7 bits (239), Expect(2) = 3e-29 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P L CR EVCKAL MAE+ CELSMGMSGDFEQAIE+GST+VRIGSTIFGPR+Y K Sbjct: 182 PENFRMLSKCRTEVCKALAMAEEHCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPK 241 Query: 347 K 345 K Sbjct: 242 K 242 Score = 59.3 bits (142), Expect(2) = 3e-29 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLD+AVSNLGRNPLKVLVQVNTSGEE Sbjct: 112 KIANHLDRAVSNLGRNPLKVLVQVNTSGEE 141 >ref|XP_002518437.1| proline synthetase associated protein, putative [Ricinus communis] gi|223542282|gb|EEF43824.1| proline synthetase associated protein, putative [Ricinus communis] Length = 270 Score = 99.0 bits (245), Expect(2) = 9e-29 Identities = 46/61 (75%), Positives = 52/61 (85%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCR+EVCK LG+ E+QCELSMGMS DFEQAIE+GST+VRIGSTIFGPR+Y K Sbjct: 209 PENFKTLANCRSEVCKTLGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYPK 268 Query: 347 K 345 K Sbjct: 269 K 269 Score = 55.5 bits (132), Expect(2) = 9e-29 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLD+AV NLGR PLKVLVQVNTSGEE Sbjct: 139 KIANHLDRAVGNLGRKPLKVLVQVNTSGEE 168 >ref|XP_006383876.1| hypothetical protein POPTR_0004s00800g [Populus trichocarpa] gi|550340024|gb|ERP61673.1| hypothetical protein POPTR_0004s00800g [Populus trichocarpa] Length = 272 Score = 98.6 bits (244), Expect(2) = 1e-28 Identities = 46/61 (75%), Positives = 52/61 (85%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P L NCR+EVCKALG+ E+QCELSMGMS DFEQAIE+GST+VRIGSTIFGPR+Y K Sbjct: 211 PENFKALANCRSEVCKALGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYPK 270 Query: 347 K 345 K Sbjct: 271 K 271 Score = 55.5 bits (132), Expect(2) = 1e-28 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLD+AV NLGR PLKVLVQVNTSGEE Sbjct: 141 KIANHLDRAVGNLGRKPLKVLVQVNTSGEE 170 >ref|XP_003532139.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like isoformX1 [Glycine max] gi|947097641|gb|KRH46226.1| hypothetical protein GLYMA_08G319900 [Glycine max] Length = 244 Score = 98.6 bits (244), Expect(2) = 2e-28 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCR EVCKAL M E++CELSMGMSGDFE AIE+GST+VRIGSTIFGPR+YAK Sbjct: 183 PQNFQTLSNCRTEVCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAK 242 Query: 347 K 345 K Sbjct: 243 K 243 Score = 54.7 bits (130), Expect(2) = 2e-28 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 ++ANHLD+ VS LGRNPLKVLVQVNTSGEE Sbjct: 113 KVANHLDRMVSTLGRNPLKVLVQVNTSGEE 142 >ref|XP_012841976.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Erythranthe guttatus] gi|604328212|gb|EYU33880.1| hypothetical protein MIMGU_mgv1a011838mg [Erythranthe guttata] Length = 269 Score = 97.8 bits (242), Expect(2) = 5e-28 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCR EVCKALG+AE+QCELSMGMSGDFE A+E+GST+VR+GSTIFG R+Y K Sbjct: 209 PENFKTLANCRTEVCKALGIAEEQCELSMGMSGDFELAVEMGSTNVRVGSTIFGAREYPK 268 Query: 347 K 345 K Sbjct: 269 K 269 Score = 54.3 bits (129), Expect(2) = 5e-28 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLD+A+ N+GR PLKVLVQVNTSGEE Sbjct: 139 KIANHLDRAIGNIGRKPLKVLVQVNTSGEE 168 >ref|XP_004294414.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Fragaria vesca subsp. vesca] Length = 245 Score = 92.4 bits (228), Expect(2) = 6e-28 Identities = 44/61 (72%), Positives = 49/61 (80%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P L CR EVCK LGMAE+ ELSMGMSGDFEQAIE+GST+VR+GSTIFGPR+Y K Sbjct: 182 PENFRMLSKCRTEVCKELGMAEENFELSMGMSGDFEQAIEMGSTNVRVGSTIFGPREYPK 241 Query: 347 K 345 K Sbjct: 242 K 242 Score = 59.3 bits (142), Expect(2) = 6e-28 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 609 SLQIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 ++++ANHLD+AVSNLGRNPLKVLVQVNTSGEE Sbjct: 110 NVKLANHLDRAVSNLGRNPLKVLVQVNTSGEE 141 >ref|XP_006602187.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic-like isoform X2 [Glycine max] Length = 596 Score = 98.6 bits (244), Expect(2) = 1e-27 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCR EVCKAL M E++CELSMGMSGDFE AIE+GST+VRIGSTIFGPR+YAK Sbjct: 183 PQNFQTLSNCRTEVCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAK 242 Query: 347 K 345 K Sbjct: 243 K 243 Score = 52.4 bits (124), Expect(2) = 1e-27 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IAN+LD+ VS LGRNPLKVLVQVNTSGEE Sbjct: 113 KIANNLDRMVSTLGRNPLKVLVQVNTSGEE 142 >gb|KRG98709.1| hypothetical protein GLYMA_18G092500 [Glycine max] Length = 244 Score = 98.6 bits (244), Expect(2) = 1e-27 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCR EVCKAL M E++CELSMGMSGDFE AIE+GST+VRIGSTIFGPR+YAK Sbjct: 183 PQNFQTLSNCRTEVCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAK 242 Query: 347 K 345 K Sbjct: 243 K 243 Score = 52.4 bits (124), Expect(2) = 1e-27 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IAN+LD+ VS LGRNPLKVLVQVNTSGEE Sbjct: 113 KIANNLDRMVSTLGRNPLKVLVQVNTSGEE 142 >gb|KHN12521.1| Proline synthase co-transcribed bacterial like protein [Glycine soja] Length = 209 Score = 98.6 bits (244), Expect(2) = 1e-27 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCR EVCKAL M E++CELSMGMSGDFE AIE+GST+VRIGSTIFGPR+YAK Sbjct: 148 PQNFQTLSNCRTEVCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAK 207 Query: 347 K 345 K Sbjct: 208 K 208 Score = 52.4 bits (124), Expect(2) = 1e-27 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IAN+LD+ VS LGRNPLKVLVQVNTSGEE Sbjct: 78 KIANNLDRMVSTLGRNPLKVLVQVNTSGEE 107 >ref|XP_010926179.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Elaeis guineensis] Length = 243 Score = 96.3 bits (238), Expect(2) = 1e-27 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCRAEVCK LG+ E+QCELSMGMS DFEQAIE+GST+VRIGSTIFG R+Y K Sbjct: 182 PENFQTLSNCRAEVCKELGIPEEQCELSMGMSADFEQAIEMGSTNVRIGSTIFGAREYPK 241 Query: 347 K 345 K Sbjct: 242 K 242 Score = 54.3 bits (129), Expect(2) = 1e-27 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHLD+ V+NLGR PLKVLVQVNTSGEE Sbjct: 112 KIANHLDRVVANLGRKPLKVLVQVNTSGEE 141 >ref|XP_004248334.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum lycopersicum] Length = 243 Score = 99.0 bits (245), Expect(2) = 2e-27 Identities = 47/61 (77%), Positives = 51/61 (83%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TLLNCR EVCK LGMAE +CELSMGMS DFE AIE+GST+VRIGSTIFGPR+Y K Sbjct: 182 PENFKTLLNCRTEVCKVLGMAESRCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPK 241 Query: 347 K 345 K Sbjct: 242 K 242 Score = 51.2 bits (121), Expect(2) = 2e-27 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 ++AN+LD+AVS++GR PLKVLVQVNTSGEE Sbjct: 112 KLANYLDRAVSSIGRQPLKVLVQVNTSGEE 141 >ref|XP_011087040.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein, partial [Sesamum indicum] Length = 245 Score = 97.1 bits (240), Expect(2) = 3e-27 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL +CR+EVCKALG+AE+QCELSMGMSGDFE AIE+GST+VRIGSTIFG R+Y K Sbjct: 184 PENFKTLASCRSEVCKALGIAEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPK 243 Query: 347 K 345 K Sbjct: 244 K 244 Score = 52.4 bits (124), Expect(2) = 3e-27 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 +IANHL++A+ N+GR PLKVLVQVNTSGEE Sbjct: 114 KIANHLNRAIGNIGRKPLKVLVQVNTSGEE 143 >ref|XP_009762484.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Nicotiana sylvestris] Length = 243 Score = 97.8 bits (242), Expect(2) = 3e-27 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TLLNCR EVCK LGM E QCELSMGMS DFE AIE+GST+VRIGSTIFGPR+Y K Sbjct: 182 PENFKTLLNCRTEVCKVLGMGESQCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPK 241 Query: 347 K 345 + Sbjct: 242 R 242 Score = 51.6 bits (122), Expect(2) = 3e-27 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 ++ANHLD+ VS++GR PLKVLVQVNTSGEE Sbjct: 112 KLANHLDRMVSSIGRQPLKVLVQVNTSGEE 141 >gb|ABK22393.1| unknown [Picea sitchensis] Length = 244 Score = 94.4 bits (233), Expect(2) = 4e-27 Identities = 45/61 (73%), Positives = 50/61 (81%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P L CR EVCKALG++EDQCELSMGMSGDFEQAIE+GST+VRIGSTIFG R+Y Sbjct: 183 PENFEALSGCRIEVCKALGISEDQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGAREYPA 242 Query: 347 K 345 K Sbjct: 243 K 243 Score = 54.7 bits (130), Expect(2) = 4e-27 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 609 SLQIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 S ++ANHLD+AVS++GR PLKVLVQVNTSGEE Sbjct: 111 SSKVANHLDRAVSSIGRKPLKVLVQVNTSGEE 142 >ref|XP_006352515.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum tuberosum] Length = 243 Score = 97.8 bits (242), Expect(2) = 4e-27 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TLLNCR EVCK LGMAE +CELSMGMS DFE AIE+GST+VRIGSTIFGPR+Y K Sbjct: 182 PENFKTLLNCRTEVCKVLGMAESRCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPK 241 Query: 347 K 345 + Sbjct: 242 R 242 Score = 51.2 bits (121), Expect(2) = 4e-27 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -1 Query: 603 QIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 ++AN+LD+AVS++GR PLKVLVQVNTSGEE Sbjct: 112 KLANYLDRAVSSIGRQPLKVLVQVNTSGEE 141 >ref|XP_008780848.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Phoenix dactylifera] Length = 245 Score = 94.7 bits (234), Expect(2) = 5e-27 Identities = 45/61 (73%), Positives = 51/61 (83%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P TL NCRAEVC+ LG+ E+QCELSMGMS DFEQAIE+GST+VRIGSTIFG R+Y K Sbjct: 181 PENFKTLSNCRAEVCQELGIPEEQCELSMGMSADFEQAIEMGSTNVRIGSTIFGAREYPK 240 Query: 347 K 345 K Sbjct: 241 K 241 Score = 53.9 bits (128), Expect(2) = 5e-27 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 606 LQIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 ++IANHLD+AV+NL R PLKVLVQVNTSGEE Sbjct: 110 VKIANHLDRAVANLARKPLKVLVQVNTSGEE 140 >ref|XP_009392906.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Musa acuminata subsp. malaccensis] Length = 248 Score = 93.6 bits (231), Expect(2) = 8e-27 Identities = 45/61 (73%), Positives = 51/61 (83%) Frame = -2 Query: 527 PVEKNTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIELGSTSVRIGSTIFGPRDYAK 348 P L NCR +VCKALG+ E+Q ELSMGMSGDFEQAIE+GST+VRIGSTIFGPR+Y K Sbjct: 184 PENFRMLSNCRNDVCKALGVPEEQFELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPK 243 Query: 347 K 345 K Sbjct: 244 K 244 Score = 54.3 bits (129), Expect(2) = 8e-27 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 609 SLQIANHLDKAVSNLGRNPLKVLVQVNTSGEE 514 S +IANHLD+AV++LGR PLKVLVQVNTSGEE Sbjct: 112 SEKIANHLDRAVASLGRKPLKVLVQVNTSGEE 143