BLASTX nr result
ID: Zanthoxylum22_contig00005156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00005156 (628 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP44492.1| hypothetical protein JCGZ_16325 [Jatropha curcas] 62 3e-07 ref|XP_010097466.1| DNA-directed RNA polymerases I, II, and III ... 62 3e-07 ref|XP_002264322.1| PREDICTED: DNA-directed RNA polymerases II, ... 61 5e-07 gb|KHG12259.1| Polr2k [Gossypium arboreum] 61 6e-07 gb|EEE62363.1| hypothetical protein OsJ_17152 [Oryza sativa Japo... 60 1e-06 ref|NP_198917.1| DNA-directed RNA polymerase NRPB12/NRPD12/NRPE1... 59 2e-06 ref|XP_010441263.1| PREDICTED: DNA-directed RNA polymerases II, ... 59 2e-06 ref|XP_010436041.1| PREDICTED: DNA-directed RNA polymerases II, ... 59 2e-06 emb|CDY24079.1| BnaA06g00770D [Brassica napus] 59 2e-06 emb|CDY25691.1| BnaC03g69840D [Brassica napus] 59 2e-06 emb|CDY25829.1| BnaA05g14200D [Brassica napus] gi|674930861|emb|... 59 2e-06 ref|XP_006405406.1| hypothetical protein EUTSA_v10028022mg [Eutr... 59 2e-06 ref|XP_006392763.1| hypothetical protein EUTSA_v10011934mg [Eutr... 59 2e-06 ref|XP_010647638.1| PREDICTED: DNA-directed RNA polymerases II, ... 59 3e-06 ref|XP_002527516.1| DNA-directed RNA polymerases I, II, and III ... 59 3e-06 ref|XP_003563174.1| PREDICTED: DNA-directed RNA polymerases II, ... 58 4e-06 gb|KHM99727.1| DNA-directed RNA polymerases I, II, and III subun... 58 5e-06 gb|KFK33039.1| hypothetical protein AALP_AA6G322600 [Arabis alpina] 58 5e-06 gb|EEC78536.1| hypothetical protein OsI_18488 [Oryza sativa Indi... 58 5e-06 ref|XP_012836463.1| PREDICTED: DNA-directed RNA polymerases II, ... 57 7e-06 >gb|KDP44492.1| hypothetical protein JCGZ_16325 [Jatropha curcas] Length = 80 Score = 62.0 bits (149), Expect = 3e-07 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRS-NFHFSF-DLIIWVYDL 488 DC ENTLK GDVIQCRECGY I YK RTRRS F+F+ LII VY L Sbjct: 14 DCGMENTLKPGDVIQCRECGYRILYKKRTRRSMQFYFALCYLIILVYRL 62 >ref|XP_010097466.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Morus notabilis] gi|587879694|gb|EXB68657.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Morus notabilis] Length = 132 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRSNFHFSFDLII 503 DC ENTLK GDVIQCRECGY I YK RTRRS F + + +I Sbjct: 68 DCGMENTLKPGDVIQCRECGYRILYKKRTRRSMFSYFIEYMI 109 >ref|XP_002264322.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Vitis vinifera] gi|731422675|ref|XP_010662205.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Vitis vinifera] gi|298204812|emb|CBI25645.3| unnamed protein product [Vitis vinifera] Length = 51 Score = 61.2 bits (147), Expect = 5e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLK GDVIQCRECGYCI YK RTRR Sbjct: 14 DCGQENTLKLGDVIQCRECGYCILYKKRTRR 44 >gb|KHG12259.1| Polr2k [Gossypium arboreum] Length = 68 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRSN 530 DC +ENTLK GDVIQCRECGY I YK RTRRSN Sbjct: 14 DCGQENTLKHGDVIQCRECGYRILYKKRTRRSN 46 >gb|EEE62363.1| hypothetical protein OsJ_17152 [Oryza sativa Japonica Group] Length = 50 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRSNFH 524 DC ENTLK GDVIQCRECGY I YK RTRRS F+ Sbjct: 15 DCGAENTLKPGDVIQCRECGYRILYKKRTRRSMFN 49 >ref|NP_198917.1| DNA-directed RNA polymerase NRPB12/NRPD12/NRPE12 [Arabidopsis thaliana] gi|75171496|sp|Q9FLM8.1|NRPBC_ARATH RecName: Full=DNA-directed RNA polymerases II, IV and V subunit 12; AltName: Full=DNA-directed RNA Polymerase II subunit K gi|9759147|dbj|BAB09703.1| unnamed protein product [Arabidopsis thaliana] gi|15028303|gb|AAK76628.1| unknown protein [Arabidopsis thaliana] gi|19310615|gb|AAL85038.1| unknown protein [Arabidopsis thaliana] gi|21618239|gb|AAM67289.1| DNA directed RNA polymerase II polypeptide K [Arabidopsis thaliana] gi|332007242|gb|AED94625.1| DNA-directed RNA polymerase NRPB12/NRPD12/NRPE12 [Arabidopsis thaliana] Length = 51 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 14 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 44 >ref|XP_010441263.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12-like [Camelina sativa] Length = 93 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 56 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 86 >ref|XP_010436041.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Camelina sativa] Length = 78 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 41 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 71 >emb|CDY24079.1| BnaA06g00770D [Brassica napus] Length = 104 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 67 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 97 >emb|CDY25691.1| BnaC03g69840D [Brassica napus] Length = 68 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 14 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 44 >emb|CDY25829.1| BnaA05g14200D [Brassica napus] gi|674930861|emb|CDY02497.1| BnaA08g01040D [Brassica napus] Length = 51 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 14 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 44 >ref|XP_006405406.1| hypothetical protein EUTSA_v10028022mg [Eutrema salsugineum] gi|557106544|gb|ESQ46859.1| hypothetical protein EUTSA_v10028022mg [Eutrema salsugineum] Length = 51 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 14 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 44 >ref|XP_006392763.1| hypothetical protein EUTSA_v10011934mg [Eutrema salsugineum] gi|567131670|ref|XP_006392764.1| hypothetical protein EUTSA_v10011934mg [Eutrema salsugineum] gi|567131674|ref|XP_006392765.1| hypothetical protein EUTSA_v10011934mg [Eutrema salsugineum] gi|557089341|gb|ESQ30049.1| hypothetical protein EUTSA_v10011934mg [Eutrema salsugineum] gi|557089342|gb|ESQ30050.1| hypothetical protein EUTSA_v10011934mg [Eutrema salsugineum] gi|557089343|gb|ESQ30051.1| hypothetical protein EUTSA_v10011934mg [Eutrema salsugineum] Length = 51 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 14 DCGQENTLKSGDVIQCRECGYRILYKKRTRR 44 >ref|XP_010647638.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12-like, partial [Vitis vinifera] Length = 64 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRS 533 DC +ENTLK GDVIQCRECGY I YK RTRRS Sbjct: 4 DCGQENTLKPGDVIQCRECGYRILYKKRTRRS 35 >ref|XP_002527516.1| DNA-directed RNA polymerases I, II, and III 7.0 kDa polypeptide, putative [Ricinus communis] gi|223533156|gb|EEF34914.1| DNA-directed RNA polymerases I, II, and III 7.0 kDa polypeptide, putative [Ricinus communis] Length = 51 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRSN 530 DC ENTLK GDVIQCRECGY I YK RTRRS+ Sbjct: 14 DCGMENTLKQGDVIQCRECGYRILYKKRTRRSS 46 >ref|XP_003563174.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Brachypodium distachyon] gi|357145250|ref|XP_003573577.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Brachypodium distachyon] gi|944060090|gb|KQJ95680.1| hypothetical protein BRADI_3g18520 [Brachypodium distachyon] gi|944081079|gb|KQK16431.1| hypothetical protein BRADI_1g28715 [Brachypodium distachyon] Length = 52 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC ENTLKSGDVIQCRECGY I YK RTRR Sbjct: 15 DCGAENTLKSGDVIQCRECGYRILYKKRTRR 45 >gb|KHM99727.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Glycine soja] Length = 1185 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRS 533 DC ENTLK GDVIQCRECGY I YK RTRRS Sbjct: 14 DCGMENTLKPGDVIQCRECGYRILYKKRTRRS 45 >gb|KFK33039.1| hypothetical protein AALP_AA6G322600 [Arabis alpina] Length = 51 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLK+GDVIQCRECGY I YK RTRR Sbjct: 14 DCGQENTLKTGDVIQCRECGYRILYKKRTRR 44 >gb|EEC78536.1| hypothetical protein OsI_18488 [Oryza sativa Indica Group] Length = 87 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRRS 533 DC ENTLK GDVIQCRECGY I YK RTRRS Sbjct: 15 DCGAENTLKPGDVIQCRECGYRILYKKRTRRS 46 >ref|XP_012836463.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Erythranthe guttatus] gi|848900805|ref|XP_012850578.1| PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 12 [Erythranthe guttatus] gi|604312765|gb|EYU26259.1| hypothetical protein MIMGU_mgv1a017602mg [Erythranthe guttata] gi|604334021|gb|EYU38219.1| hypothetical protein MIMGU_mgv1a017594mg [Erythranthe guttata] Length = 51 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 628 DCVRENTLKSGDVIQCRECGYCIFYKNRTRR 536 DC +ENTLK GDVIQCRECGY I YK RTRR Sbjct: 14 DCGQENTLKQGDVIQCRECGYRILYKKRTRR 44