BLASTX nr result
ID: Zanthoxylum22_contig00005143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00005143 (730 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430991.1| hypothetical protein CICLE_v10011669mg [Citr... 68 5e-09 gb|KDO72335.1| hypothetical protein CISIN_1g012508mg [Citrus sin... 66 2e-08 ref|XP_006482461.1| PREDICTED: probable sodium-coupled neutral a... 66 3e-08 ref|XP_012491238.1| PREDICTED: probable sodium-coupled neutral a... 57 1e-05 gb|KHG17920.1| putative sodium-coupled neutral amino acid transp... 57 1e-05 >ref|XP_006430991.1| hypothetical protein CICLE_v10011669mg [Citrus clementina] gi|557533048|gb|ESR44231.1| hypothetical protein CICLE_v10011669mg [Citrus clementina] Length = 462 Score = 68.2 bits (165), Expect = 5e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -2 Query: 114 MTIGSITPKDKHSRRSKRVVDENAPLLPSRQDEDAGFG 1 MTIGSITPKDKHSRR K+VVDEN+PLLP+R++ DAG+G Sbjct: 1 MTIGSITPKDKHSRRGKKVVDENSPLLPTRREGDAGYG 38 >gb|KDO72335.1| hypothetical protein CISIN_1g012508mg [Citrus sinensis] Length = 462 Score = 66.2 bits (160), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 114 MTIGSITPKDKHSRRSKRVVDENAPLLPSRQDEDAGFG 1 M IGSITPKDKHSRR K+VVDEN+PLLP+R++ DAG+G Sbjct: 1 MAIGSITPKDKHSRRGKKVVDENSPLLPTRREGDAGYG 38 >ref|XP_006482461.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Citrus sinensis] Length = 462 Score = 65.9 bits (159), Expect = 3e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 114 MTIGSITPKDKHSRRSKRVVDENAPLLPSRQDEDAGFG 1 MTIGSITPKDKHS R K+VVDEN+PLLP+R++ DAG+G Sbjct: 1 MTIGSITPKDKHSSRGKKVVDENSPLLPTRREGDAGYG 38 >ref|XP_012491238.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Gossypium raimondii] gi|823190728|ref|XP_012491240.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Gossypium raimondii] gi|763775858|gb|KJB42981.1| hypothetical protein B456_007G178200 [Gossypium raimondii] gi|763775859|gb|KJB42982.1| hypothetical protein B456_007G178200 [Gossypium raimondii] gi|763775860|gb|KJB42983.1| hypothetical protein B456_007G178200 [Gossypium raimondii] gi|763775861|gb|KJB42984.1| hypothetical protein B456_007G178200 [Gossypium raimondii] Length = 464 Score = 57.4 bits (137), Expect = 1e-05 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 114 MTIGSITPK-DKHSRRSKRVVDENAPLLPSRQDEDAGF 4 MTIG ITPK ++ SRRSK VVD+ APLLP RQDEDAG+ Sbjct: 1 MTIGDITPKKERKSRRSKHVVDDTAPLLPKRQDEDAGY 38 >gb|KHG17920.1| putative sodium-coupled neutral amino acid transporter 6 [Gossypium arboreum] Length = 464 Score = 57.4 bits (137), Expect = 1e-05 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 114 MTIGSITPK-DKHSRRSKRVVDENAPLLPSRQDEDAGF 4 MTIG ITPK ++ SRRSK VVD+ APLLP RQDEDAG+ Sbjct: 1 MTIGDITPKKERKSRRSKHVVDDTAPLLPKRQDEDAGY 38