BLASTX nr result
ID: Zanthoxylum22_contig00004225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00004225 (355 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006448266.1| hypothetical protein CICLE_v10014786mg [Citr... 63 1e-07 gb|KDO64672.1| hypothetical protein CISIN_1g012982mg [Citrus sin... 61 4e-07 ref|XP_006469171.1| PREDICTED: serine carboxypeptidase-like 50-l... 61 4e-07 >ref|XP_006448266.1| hypothetical protein CICLE_v10014786mg [Citrus clementina] gi|557550877|gb|ESR61506.1| hypothetical protein CICLE_v10014786mg [Citrus clementina] Length = 556 Score = 62.8 bits (151), Expect = 1e-07 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = -3 Query: 149 KMKSTIAMYFLC---FVLHHTXXXXXSLLPKEALPTRSGYLPVNAATGSAIF 3 KMKST +YFL F LHH+ LLPKEALPT+SGYLPVN ATGSAIF Sbjct: 104 KMKSTTTIYFLFCFFFFLHHSPSSSS-LLPKEALPTKSGYLPVNPATGSAIF 154 >gb|KDO64672.1| hypothetical protein CISIN_1g012982mg [Citrus sinensis] Length = 452 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = -3 Query: 146 MKSTIAMYFLC---FVLHHTXXXXXSLLPKEALPTRSGYLPVNAATGSAIF 3 MKST +YFL F LHH+ LLPKEALPT+SGYLPVN ATGSAIF Sbjct: 1 MKSTTTIYFLFCFFFFLHHSPSSSS-LLPKEALPTKSGYLPVNPATGSAIF 50 >ref|XP_006469171.1| PREDICTED: serine carboxypeptidase-like 50-like [Citrus sinensis] Length = 452 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = -3 Query: 146 MKSTIAMYFLC---FVLHHTXXXXXSLLPKEALPTRSGYLPVNAATGSAIF 3 MKST +YFL F LHH+ LLPKEALPT+SGYLPVN ATGSAIF Sbjct: 1 MKSTTTIYFLFCFFFFLHHSPSSSS-LLPKEALPTKSGYLPVNPATGSAIF 50