BLASTX nr result
ID: Zanthoxylum22_contig00004199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00004199 (1442 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO67329.1| hypothetical protein CISIN_1g041411mg [Citrus sin... 79 1e-11 >gb|KDO67329.1| hypothetical protein CISIN_1g041411mg [Citrus sinensis] Length = 95 Score = 79.0 bits (193), Expect = 1e-11 Identities = 42/59 (71%), Positives = 42/59 (71%) Frame = +1 Query: 595 FLFSFVSRTRCLLGLPHWFCGSTLHWGFILCRPATVSSILHHSSLPRNGIFNFASLCSA 771 FLF FVSRTRCLLGL HWF GSTL WGFILC PA SSIL HS LP N F F C A Sbjct: 3 FLFLFVSRTRCLLGLHHWFSGSTLPWGFILCCPAMGSSILLHSLLPCNQ-FCFIVCCPA 60