BLASTX nr result
ID: Zanthoxylum22_contig00003265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00003265 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006425356.1| hypothetical protein CICLE_v10027470mg [Citr... 71 3e-10 >ref|XP_006425356.1| hypothetical protein CICLE_v10027470mg [Citrus clementina] gi|557527346|gb|ESR38596.1| hypothetical protein CICLE_v10027470mg [Citrus clementina] Length = 197 Score = 71.2 bits (173), Expect = 3e-10 Identities = 40/73 (54%), Positives = 48/73 (65%), Gaps = 2/73 (2%) Frame = -2 Query: 214 IMEKPWKIKGRILAFLPKVATSAVTFQLSPPLSPVXXXXXXXXXXXXXXXXXXK--NSSF 41 ++E+ WKIKG+I+A LPK AT +TF++SPPLSPV K NSSF Sbjct: 1 MLERKWKIKGKIMALLPKAATP-LTFRISPPLSPVKAGAGTRKIPIIPKEARRKPKNSSF 59 Query: 40 EQKEPASPKVSCM 2 EQKEPASPKVSCM Sbjct: 60 EQKEPASPKVSCM 72