BLASTX nr result
ID: Zanthoxylum22_contig00002021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00002021 (680 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO67329.1| hypothetical protein CISIN_1g041411mg [Citrus sin... 73 2e-10 >gb|KDO67329.1| hypothetical protein CISIN_1g041411mg [Citrus sinensis] Length = 95 Score = 72.8 bits (177), Expect = 2e-10 Identities = 36/50 (72%), Positives = 37/50 (74%) Frame = -1 Query: 182 LAFFFSLVSRTRCLLGLPHWFCGSTLPLGFILCRPATVSSILHHSSLPRN 33 + F F VSRTRCLLGL HWF GSTLP GFILC PA SSIL HS LP N Sbjct: 1 MLFLFLFVSRTRCLLGLHHWFSGSTLPWGFILCCPAMGSSILLHSLLPCN 50