BLASTX nr result
ID: Zanthoxylum22_contig00002014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00002014 (505 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_085545.1| hypothetical protein ArthMp078 [Arabidopsis tha... 64 6e-08 >ref|NP_085545.1| hypothetical protein ArthMp078 [Arabidopsis thaliana] gi|45477048|sp|P92526.1|M890_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg00890; AltName: Full=ORF106d gi|1785747|emb|CAA69831.1| unnamed protein product [Arabidopsis thaliana] Length = 106 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -2 Query: 489 MHLERSVQLLLTKFIHIAGPYSLWGTSLAQHSFKTSTRSFTHKR 358 MHLERSVQ LT+ IA PYSLWG SLAQHSFKTSTRS KR Sbjct: 1 MHLERSVQSQLTESKEIARPYSLWGISLAQHSFKTSTRSTGKKR 44