BLASTX nr result
ID: Zanthoxylum22_contig00000397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00000397 (454 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO85132.1| hypothetical protein CISIN_1g031906mg [Citrus sin... 77 5e-12 gb|KDO85123.1| hypothetical protein CISIN_1g031906mg [Citrus sin... 77 5e-12 gb|KDO85122.1| hypothetical protein CISIN_1g031906mg [Citrus sin... 77 5e-12 ref|XP_006473803.1| PREDICTED: high mobility group B protein 2-l... 77 5e-12 ref|XP_006435383.1| hypothetical protein CICLE_v10002782mg [Citr... 77 5e-12 ref|XP_006435381.1| hypothetical protein CICLE_v10002782mg [Citr... 77 5e-12 ref|XP_006435380.1| hypothetical protein CICLE_v10002782mg [Citr... 77 5e-12 gb|KDO85125.1| hypothetical protein CISIN_1g031906mg [Citrus sin... 75 1e-11 gb|KDO85124.1| hypothetical protein CISIN_1g031906mg [Citrus sin... 75 1e-11 gb|KJB14229.1| hypothetical protein B456_002G115100 [Gossypium r... 75 2e-11 gb|KJB14227.1| hypothetical protein B456_002G115100 [Gossypium r... 75 2e-11 gb|KJB14226.1| hypothetical protein B456_002G115100 [Gossypium r... 75 2e-11 gb|KJB14225.1| hypothetical protein B456_002G115100 [Gossypium r... 75 2e-11 gb|KJB14224.1| hypothetical protein B456_002G115100 [Gossypium r... 75 2e-11 ref|XP_012464506.1| PREDICTED: high mobility group B protein 3-l... 75 2e-11 ref|XP_002272299.1| PREDICTED: HMG1/2-like protein [Vitis vinife... 75 2e-11 gb|ADO34795.1| high mobility group box 1 protein [Gossypium hirs... 75 2e-11 ref|XP_007018067.1| High mobility group B2, BETA 1,NFD2,NFD02 is... 75 2e-11 gb|KJB29495.1| hypothetical protein B456_005G114500, partial [Go... 73 9e-11 gb|KJB29494.1| hypothetical protein B456_005G114500, partial [Go... 73 9e-11 >gb|KDO85132.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] Length = 98 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQA Sbjct: 25 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 63 >gb|KDO85123.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] Length = 150 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQA Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111 >gb|KDO85122.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] Length = 141 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQA Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111 >ref|XP_006473803.1| PREDICTED: high mobility group B protein 2-like isoform X1 [Citrus sinensis] Length = 166 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQA Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111 >ref|XP_006435383.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] gi|557537505|gb|ESR48623.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] Length = 148 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQA Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111 >ref|XP_006435381.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] gi|567885647|ref|XP_006435382.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] gi|568839673|ref|XP_006473804.1| PREDICTED: high mobility group B protein 2-like isoform X2 [Citrus sinensis] gi|557537503|gb|ESR48621.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] gi|557537504|gb|ESR48622.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] gi|641866433|gb|KDO85118.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] gi|641866434|gb|KDO85119.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] gi|641866435|gb|KDO85120.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] Length = 146 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQA Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111 >ref|XP_006435380.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] gi|557537502|gb|ESR48620.1| hypothetical protein CICLE_v10002782mg [Citrus clementina] gi|641866436|gb|KDO85121.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] Length = 133 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQA Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111 >gb|KDO85125.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] gi|641866441|gb|KDO85126.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] gi|641866442|gb|KDO85127.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] Length = 113 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQ 340 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQ Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQ 110 >gb|KDO85124.1| hypothetical protein CISIN_1g031906mg [Citrus sinensis] Length = 145 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQ 340 GGEKWKSMSEA+KAPYV+KAEKRKV+YEKDMK+YN+RQ Sbjct: 73 GGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQ 110 >gb|KJB14229.1| hypothetical protein B456_002G115100 [Gossypium raimondii] Length = 141 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEKAPYV+KAEKRKV+YEK+MK+YNKRQA Sbjct: 70 GGDKWKSLSEAEKAPYVAKAEKRKVEYEKNMKAYNKRQA 108 >gb|KJB14227.1| hypothetical protein B456_002G115100 [Gossypium raimondii] Length = 142 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEKAPYV+KAEKRKV+YEK+MK+YNKRQA Sbjct: 70 GGDKWKSLSEAEKAPYVAKAEKRKVEYEKNMKAYNKRQA 108 >gb|KJB14226.1| hypothetical protein B456_002G115100 [Gossypium raimondii] Length = 97 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEKAPYV+KAEKRKV+YEK+MK+YNKRQA Sbjct: 25 GGDKWKSLSEAEKAPYVAKAEKRKVEYEKNMKAYNKRQA 63 >gb|KJB14225.1| hypothetical protein B456_002G115100 [Gossypium raimondii] Length = 141 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEKAPYV+KAEKRKV+YEK+MK+YNKRQA Sbjct: 70 GGDKWKSLSEAEKAPYVAKAEKRKVEYEKNMKAYNKRQA 108 >gb|KJB14224.1| hypothetical protein B456_002G115100 [Gossypium raimondii] Length = 103 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEKAPYV+KAEKRKV+YEK+MK+YNKRQA Sbjct: 31 GGDKWKSLSEAEKAPYVAKAEKRKVEYEKNMKAYNKRQA 69 >ref|XP_012464506.1| PREDICTED: high mobility group B protein 3-like [Gossypium raimondii] gi|763746784|gb|KJB14223.1| hypothetical protein B456_002G115100 [Gossypium raimondii] gi|763746789|gb|KJB14228.1| hypothetical protein B456_002G115100 [Gossypium raimondii] Length = 142 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEKAPYV+KAEKRKV+YEK+MK+YNKRQA Sbjct: 70 GGDKWKSLSEAEKAPYVAKAEKRKVEYEKNMKAYNKRQA 108 >ref|XP_002272299.1| PREDICTED: HMG1/2-like protein [Vitis vinifera] gi|297745562|emb|CBI40727.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKSMSEAEKAPYV+KAEKRKV+YEK+MK+YNK+QA Sbjct: 79 GGDKWKSMSEAEKAPYVAKAEKRKVEYEKNMKAYNKKQA 117 >gb|ADO34795.1| high mobility group box 1 protein [Gossypium hirsutum] gi|728812407|gb|KHG00797.1| High mobility group B 3 -like protein [Gossypium arboreum] Length = 142 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEKAPYV+KAEKRKV+YEK+MK+YNKRQA Sbjct: 70 GGDKWKSLSEAEKAPYVAKAEKRKVEYEKNMKAYNKRQA 108 >ref|XP_007018067.1| High mobility group B2, BETA 1,NFD2,NFD02 isoform 1 [Theobroma cacao] gi|590595481|ref|XP_007018068.1| High mobility group B2, BETA 1,NFD2,NFD02 isoform 1 [Theobroma cacao] gi|508723395|gb|EOY15292.1| High mobility group B2, BETA 1,NFD2,NFD02 isoform 1 [Theobroma cacao] gi|508723396|gb|EOY15293.1| High mobility group B2, BETA 1,NFD2,NFD02 isoform 1 [Theobroma cacao] Length = 147 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKSMSEAEKAP+V+KAEKRKV+YEK+MK+YNKRQA Sbjct: 74 GGDKWKSMSEAEKAPFVAKAEKRKVEYEKNMKAYNKRQA 112 >gb|KJB29495.1| hypothetical protein B456_005G114500, partial [Gossypium raimondii] Length = 199 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEK PYV KAEKRKV+YEK+MK+YNKRQA Sbjct: 127 GGDKWKSLSEAEKRPYVDKAEKRKVEYEKNMKAYNKRQA 165 >gb|KJB29494.1| hypothetical protein B456_005G114500, partial [Gossypium raimondii] Length = 207 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 453 GGEKWKSMSEAEKAPYVSKAEKRKVDYEKDMKSYNKRQA 337 GG+KWKS+SEAEK PYV KAEKRKV+YEK+MK+YNKRQA Sbjct: 127 GGDKWKSLSEAEKRPYVDKAEKRKVEYEKNMKAYNKRQA 165