BLASTX nr result
ID: Zanthoxylum22_contig00000157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00000157 (540 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006442381.1| hypothetical protein CICLE_v10023107mg [Citr... 100 4e-19 ref|XP_006442383.1| hypothetical protein CICLE_v10023104mg [Citr... 93 9e-17 ref|XP_006442382.1| hypothetical protein CICLE_v10023104mg [Citr... 88 3e-15 >ref|XP_006442381.1| hypothetical protein CICLE_v10023107mg [Citrus clementina] gi|557544643|gb|ESR55621.1| hypothetical protein CICLE_v10023107mg [Citrus clementina] Length = 85 Score = 100 bits (249), Expect = 4e-19 Identities = 54/77 (70%), Positives = 60/77 (77%), Gaps = 2/77 (2%) Frame = -2 Query: 491 MAFTLGVFMPKPMLKLPTLKAYPQQRKSI-IVCANPQRPKGSTGKGGKINSENLTSLNSA 315 MAFTLG FMPK LKLPTLK Y RK I IVCANP+RP GST GG+INS+ TSLN+A Sbjct: 1 MAFTLGRFMPKTTLKLPTLKTYQLPRKGIVIVCANPERPSGSTRNGGEINSQKPTSLNNA 60 Query: 314 QIAIKET-EKNKTVTED 267 QIA+KET +KNK V ED Sbjct: 61 QIAVKETADKNKAVKED 77 >ref|XP_006442383.1| hypothetical protein CICLE_v10023104mg [Citrus clementina] gi|557544645|gb|ESR55623.1| hypothetical protein CICLE_v10023104mg [Citrus clementina] Length = 85 Score = 92.8 bits (229), Expect = 9e-17 Identities = 50/77 (64%), Positives = 56/77 (72%), Gaps = 2/77 (2%) Frame = -2 Query: 491 MAFTLGVFMPKPMLKLPTLKAYPQQRKSI-IVCANPQRPKGSTGKGGKINSENLTSLNSA 315 MAFTL FMPK LKLPT K Y Q RK + IVC+NP RP GS G GGKINSE SLN+A Sbjct: 1 MAFTLASFMPKTTLKLPTFKTYQQPRKGVVIVCSNPTRPGGSHGGGGKINSEKPKSLNNA 60 Query: 314 QIAIKET-EKNKTVTED 267 QI +KE+ +KNK V ED Sbjct: 61 QIEVKESADKNKAVKED 77 >ref|XP_006442382.1| hypothetical protein CICLE_v10023104mg [Citrus clementina] gi|557544644|gb|ESR55622.1| hypothetical protein CICLE_v10023104mg [Citrus clementina] Length = 82 Score = 87.8 bits (216), Expect = 3e-15 Identities = 47/76 (61%), Positives = 54/76 (71%), Gaps = 1/76 (1%) Frame = -2 Query: 491 MAFTLGVFMPKPMLKLPTLKAYPQQRKSIIVCANPQRPKGSTGKGGKINSENLTSLNSAQ 312 MAFTL FMPK LKLPT K Y Q RK +++ NP RP GS G GGKINSE SLN+AQ Sbjct: 1 MAFTLASFMPKTTLKLPTFKTYQQPRKGVVI--NPTRPGGSHGGGGKINSEKPKSLNNAQ 58 Query: 311 IAIKET-EKNKTVTED 267 I +KE+ +KNK V ED Sbjct: 59 IEVKESADKNKAVKED 74