BLASTX nr result
ID: Wisteria21_contig00040318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00040318 (372 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH54869.1| hypothetical protein GLYMA_06G215500 [Glycine max] 56 9e-06 >gb|KRH54869.1| hypothetical protein GLYMA_06G215500 [Glycine max] Length = 575 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -3 Query: 361 TMHYGGDED-LRDPVRVRTKGSCSQIPLSGGSRARRRTQCGFCKQPGHNRRSCPDRP 194 T HYG D D + DPV VR+KG C Q+ + R RR +CG C GHN+RSC +RP Sbjct: 490 TEHYGDDFDGILDPVVVRSKG-CGQVGMDECDRQRRIQKCGQCSGIGHNKRSCTNRP 545