BLASTX nr result
ID: Wisteria21_contig00040225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00040225 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM38306.1| hypothetical protein LR48_Vigan03g168800 [Vigna a... 65 2e-08 ref|XP_014496759.1| PREDICTED: ethylene-responsive transcription... 64 4e-08 ref|XP_007140776.1| hypothetical protein PHAVU_008G141000g [Phas... 64 6e-08 gb|KHN34489.1| Ethylene-responsive transcription factor ERF034 [... 60 6e-07 ref|XP_003530164.1| PREDICTED: ethylene-responsive transcription... 60 6e-07 ref|XP_003521085.1| PREDICTED: ethylene-responsive transcription... 60 6e-07 ref|XP_003516798.1| PREDICTED: ethylene-responsive transcription... 60 6e-07 gb|ACU24100.1| unknown [Glycine max] 60 6e-07 ref|XP_010544587.1| PREDICTED: ethylene-responsive transcription... 59 1e-06 >gb|KOM38306.1| hypothetical protein LR48_Vigan03g168800 [Vigna angularis] Length = 286 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/54 (61%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQDTGNGTK-CKKRQRSDNESSKHPTYRGVRMRTWGR 10 CTKQDS+ S PP+DST AQ+ K CKKRQR+ +++ KHP+YRGVRMR WG+ Sbjct: 54 CTKQDSQTS-PPDDSTTAQNQNTPNKECKKRQRNGDDN-KHPSYRGVRMRAWGK 105 >ref|XP_014496759.1| PREDICTED: ethylene-responsive transcription factor ERF034-like [Vigna radiata var. radiata] Length = 323 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQDTGNGTK-CKKRQRSDNESSKHPTYRGVRMRTWGR 10 CTKQDS+ S PP+DST A++ K CKKRQR+ +++ KHP+YRGVRMR WG+ Sbjct: 91 CTKQDSQTS-PPDDSTTAKNQNTPNKECKKRQRNGDDN-KHPSYRGVRMRAWGK 142 >ref|XP_007140776.1| hypothetical protein PHAVU_008G141000g [Phaseolus vulgaris] gi|561013909|gb|ESW12770.1| hypothetical protein PHAVU_008G141000g [Phaseolus vulgaris] Length = 309 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQD--TGNGTKCKKRQRSDNESSKHPTYRGVRMRTWGR 10 CTKQDS+ S PP+DSTR Q+ T N + KKRQR+ +++ KHP+YRGVRMR WG+ Sbjct: 77 CTKQDSQTS-PPDDSTRPQNKNTPNSKERKKRQRNGSDN-KHPSYRGVRMRAWGK 129 >gb|KHN34489.1| Ethylene-responsive transcription factor ERF034 [Glycine soja] gi|947100259|gb|KRH48751.1| hypothetical protein GLYMA_07G110000 [Glycine max] Length = 266 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQ---DTGNGTK-CKKRQRSDNESSKHPTYRGVRMRTWGR 10 CTK+ SK TP NDST +Q + G +K CKKRQ ++ + HPTYRGVRMR WG+ Sbjct: 50 CTKEHSK--TPQNDSTTSQTSLENGKDSKGCKKRQIDNSNQNHHPTYRGVRMRNWGK 104 >ref|XP_003530164.1| PREDICTED: ethylene-responsive transcription factor ERF034-like [Glycine max] Length = 363 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQ---DTGNGTK-CKKRQRSDNESSKHPTYRGVRMRTWGR 10 CTK+ SK TP NDST +Q + G +K CKKRQ ++ + HPTYRGVRMR WG+ Sbjct: 147 CTKEHSK--TPQNDSTTSQTSLENGKDSKGCKKRQIDNSNQNHHPTYRGVRMRNWGK 201 >ref|XP_003521085.1| PREDICTED: ethylene-responsive transcription factor ERF034-like [Glycine max] gi|947118345|gb|KRH66594.1| hypothetical protein GLYMA_03G116700 [Glycine max] Length = 287 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQDT----GNGTKCKKRQRSDNESSKHPTYRGVRMRTWGR 10 CTK+ +K TP NDST +Q + + +CKKRQR ++ + HPTYRGVRMR WG+ Sbjct: 71 CTKEHTK--TPQNDSTISQTSLENKEDSKECKKRQRDNSNQNHHPTYRGVRMRNWGK 125 >ref|XP_003516798.1| PREDICTED: ethylene-responsive transcription factor ERF034-like [Glycine max] gi|734383376|gb|KHN23919.1| Ethylene-responsive transcription factor ERF034 [Glycine soja] gi|947127412|gb|KRH75266.1| hypothetical protein GLYMA_01G074200 [Glycine max] Length = 263 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQDTGNGTKCKKRQRSD-NESSKHPTYRGVRMRTWGR 10 CTK DSKIS P N +T KKRQRSD NE+ HP+YRGVRMR WG+ Sbjct: 39 CTKHDSKISPPQNQNT--------PNSKKRQRSDDNENKHHPSYRGVRMRAWGK 84 >gb|ACU24100.1| unknown [Glycine max] Length = 287 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQDT----GNGTKCKKRQRSDNESSKHPTYRGVRMRTWGR 10 CTK+ +K TP NDST +Q + + +CKKRQR ++ + HPTYRGVRMR WG+ Sbjct: 71 CTKEHTK--TPQNDSTISQTSLENKEDSKECKKRQRDNSNQNHHPTYRGVRMRNWGK 125 >ref|XP_010544587.1| PREDICTED: ethylene-responsive transcription factor ERF034-like [Tarenaya hassleriana] Length = 274 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -2 Query: 168 CTKQDSKISTPPNDSTRAQDTGNGTKCKKRQRSDNESSKHPTYRGVRMRTWGR 10 CT+ +S+ T S +AQD NG K K+R+ S+N S KHPTYRGVRMR+WG+ Sbjct: 50 CTEGNSRAKT----SRKAQDDNNGAK-KRRKNSENGSDKHPTYRGVRMRSWGK 97