BLASTX nr result
ID: Wisteria21_contig00040124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00040124 (298 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH03662.1| hypothetical protein GLYMA_17G111800 [Glycine max] 59 1e-06 >gb|KRH03662.1| hypothetical protein GLYMA_17G111800 [Glycine max] Length = 90 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 187 VRSEPNFALKSWSCFSTAFLNFLCILKLYSRIIKSPR 297 VRSE NF LKSWSCFSTAFLNFLCIL L + I SPR Sbjct: 33 VRSELNFPLKSWSCFSTAFLNFLCILYLSTSSILSPR 69