BLASTX nr result
ID: Wisteria21_contig00040113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00040113 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014517159.1| PREDICTED: uncharacterized protein LOC106774... 72 2e-10 gb|KOM53233.1| hypothetical protein LR48_Vigan09g189200 [Vigna a... 72 2e-10 emb|CBI25860.3| unnamed protein product [Vitis vinifera] 71 4e-10 ref|XP_002525234.1| conserved hypothetical protein [Ricinus comm... 71 4e-10 ref|XP_006467242.1| PREDICTED: uncharacterized protein LOC102628... 71 4e-10 ref|XP_006449970.1| hypothetical protein CICLE_v10014880mg [Citr... 71 4e-10 ref|XP_002269690.2| PREDICTED: uncharacterized protein LOC100253... 71 4e-10 gb|KHN14397.1| hypothetical protein glysoja_012435 [Glycine soja] 70 5e-10 ref|XP_006597631.1| PREDICTED: uncharacterized protein LOC100785... 70 5e-10 ref|XP_003546214.1| PREDICTED: uncharacterized protein LOC100785... 70 5e-10 ref|XP_003535004.1| PREDICTED: uncharacterized protein LOC100780... 70 5e-10 ref|XP_012082215.1| PREDICTED: uncharacterized protein LOC105642... 70 6e-10 ref|XP_012082214.1| PREDICTED: uncharacterized protein LOC105642... 70 6e-10 ref|XP_003594365.1| zinc finger, C3HC4 type (RING finger) protei... 70 6e-10 gb|ABN08848.1| Zinc finger, RING-type [Medicago truncatula] 70 6e-10 ref|XP_007147562.1| hypothetical protein PHAVU_006G134900g [Phas... 69 1e-09 ref|XP_011005783.1| PREDICTED: uncharacterized protein LOC105111... 69 2e-09 ref|XP_011040093.1| PREDICTED: uncharacterized protein LOC105136... 69 2e-09 ref|XP_002308735.1| hypothetical protein POPTR_0006s00300g [Popu... 69 2e-09 ref|XP_006373553.1| hypothetical protein POPTR_0016s00330g [Popu... 69 2e-09 >ref|XP_014517159.1| PREDICTED: uncharacterized protein LOC106774628 [Vigna radiata var. radiata] Length = 562 Score = 72.0 bits (175), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWDFHDPYMARRWAKHLHGYRL Sbjct: 533 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 562 >gb|KOM53233.1| hypothetical protein LR48_Vigan09g189200 [Vigna angularis] Length = 558 Score = 72.0 bits (175), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWDFHDPYMARRWAKHLHGYRL Sbjct: 529 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 558 >emb|CBI25860.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWD+HDPYMARRWAKHLHGYRL Sbjct: 489 GGRTSSVESWDYHDPYMARRWAKHLHGYRL 518 >ref|XP_002525234.1| conserved hypothetical protein [Ricinus communis] gi|223535531|gb|EEF37200.1| conserved hypothetical protein [Ricinus communis] Length = 520 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWD+HDPYMARRWAKHLHGYRL Sbjct: 491 GGRTSSVESWDYHDPYMARRWAKHLHGYRL 520 >ref|XP_006467242.1| PREDICTED: uncharacterized protein LOC102628285 [Citrus sinensis] gi|641859941|gb|KDO78631.1| hypothetical protein CISIN_1g009657mg [Citrus sinensis] Length = 529 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWD+HDPYMARRWAKHLHGYRL Sbjct: 500 GGRTSSVESWDYHDPYMARRWAKHLHGYRL 529 >ref|XP_006449970.1| hypothetical protein CICLE_v10014880mg [Citrus clementina] gi|557552581|gb|ESR63210.1| hypothetical protein CICLE_v10014880mg [Citrus clementina] Length = 530 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWD+HDPYMARRWAKHLHGYRL Sbjct: 501 GGRTSSVESWDYHDPYMARRWAKHLHGYRL 530 >ref|XP_002269690.2| PREDICTED: uncharacterized protein LOC100253188 [Vitis vinifera] gi|147840889|emb|CAN66503.1| hypothetical protein VITISV_035496 [Vitis vinifera] Length = 523 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWD+HDPYMARRWAKHLHGYRL Sbjct: 494 GGRTSSVESWDYHDPYMARRWAKHLHGYRL 523 >gb|KHN14397.1| hypothetical protein glysoja_012435 [Glycine soja] Length = 553 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWDFHDPYMARRWAKHLHGYRL Sbjct: 524 GGRSSSVESWDFHDPYMARRWAKHLHGYRL 553 >ref|XP_006597631.1| PREDICTED: uncharacterized protein LOC100785882 isoform X2 [Glycine max] Length = 562 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWDFHDPYMARRWAKHLHGYRL Sbjct: 533 GGRSSSVESWDFHDPYMARRWAKHLHGYRL 562 >ref|XP_003546214.1| PREDICTED: uncharacterized protein LOC100785882 isoform X1 [Glycine max] gi|947062393|gb|KRH11654.1| hypothetical protein GLYMA_15G122900 [Glycine max] Length = 553 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWDFHDPYMARRWAKHLHGYRL Sbjct: 524 GGRSSSVESWDFHDPYMARRWAKHLHGYRL 553 >ref|XP_003535004.1| PREDICTED: uncharacterized protein LOC100780745 [Glycine max] gi|734420371|gb|KHN40758.1| hypothetical protein glysoja_015125 [Glycine soja] gi|947088000|gb|KRH36665.1| hypothetical protein GLYMA_09G017200 [Glycine max] Length = 550 Score = 70.5 bits (171), Expect = 5e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWDFHDPYMARRWAKHLHGYRL Sbjct: 521 GGRSSSVESWDFHDPYMARRWAKHLHGYRL 550 >ref|XP_012082215.1| PREDICTED: uncharacterized protein LOC105642125 isoform X2 [Jatropha curcas] Length = 532 Score = 70.1 bits (170), Expect = 6e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWD+HDPYMARRWAKHLHGYR+ Sbjct: 503 GGRTSSVESWDYHDPYMARRWAKHLHGYRI 532 >ref|XP_012082214.1| PREDICTED: uncharacterized protein LOC105642125 isoform X1 [Jatropha curcas] gi|643717584|gb|KDP29027.1| hypothetical protein JCGZ_16416 [Jatropha curcas] Length = 533 Score = 70.1 bits (170), Expect = 6e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWD+HDPYMARRWAKHLHGYR+ Sbjct: 504 GGRTSSVESWDYHDPYMARRWAKHLHGYRI 533 >ref|XP_003594365.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] gi|355483413|gb|AES64616.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] Length = 554 Score = 70.1 bits (170), Expect = 6e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 302 TGGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 TGGR+SSVESWDFHDPYMARRWAK+LHGYRL Sbjct: 524 TGGRSSSVESWDFHDPYMARRWAKYLHGYRL 554 >gb|ABN08848.1| Zinc finger, RING-type [Medicago truncatula] Length = 463 Score = 70.1 bits (170), Expect = 6e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 302 TGGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 TGGR+SSVESWDFHDPYMARRWAK+LHGYRL Sbjct: 433 TGGRSSSVESWDFHDPYMARRWAKYLHGYRL 463 >ref|XP_007147562.1| hypothetical protein PHAVU_006G134900g [Phaseolus vulgaris] gi|561020785|gb|ESW19556.1| hypothetical protein PHAVU_006G134900g [Phaseolus vulgaris] Length = 559 Score = 69.3 bits (168), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGRTSSVESWDFH PYMARRWAKHLHGYRL Sbjct: 530 GGRTSSVESWDFHGPYMARRWAKHLHGYRL 559 >ref|XP_011005783.1| PREDICTED: uncharacterized protein LOC105111957 [Populus euphratica] Length = 541 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWD+HDPYMARRWAKHLHGYR+ Sbjct: 512 GGRSSSVESWDYHDPYMARRWAKHLHGYRI 541 >ref|XP_011040093.1| PREDICTED: uncharacterized protein LOC105136442 [Populus euphratica] Length = 539 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWD+HDPYMARRWAKHLHGYR+ Sbjct: 510 GGRSSSVESWDYHDPYMARRWAKHLHGYRI 539 >ref|XP_002308735.1| hypothetical protein POPTR_0006s00300g [Populus trichocarpa] gi|222854711|gb|EEE92258.1| hypothetical protein POPTR_0006s00300g [Populus trichocarpa] Length = 542 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWD+HDPYMARRWAKHLHGYR+ Sbjct: 513 GGRSSSVESWDYHDPYMARRWAKHLHGYRI 542 >ref|XP_006373553.1| hypothetical protein POPTR_0016s00330g [Populus trichocarpa] gi|550320463|gb|ERP51350.1| hypothetical protein POPTR_0016s00330g [Populus trichocarpa] Length = 539 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 299 GGRTSSVESWDFHDPYMARRWAKHLHGYRL 210 GGR+SSVESWD+HDPYMARRWAKHLHGYR+ Sbjct: 510 GGRSSSVESWDYHDPYMARRWAKHLHGYRI 539