BLASTX nr result
ID: Wisteria21_contig00040030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00040030 (434 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014500530.1| PREDICTED: putative uncharacterized protein ... 58 2e-06 gb|KOM51592.1| hypothetical protein LR48_Vigan09g025100 [Vigna a... 58 3e-06 >ref|XP_014500530.1| PREDICTED: putative uncharacterized protein DDB_G0290521 [Vigna radiata var. radiata] Length = 350 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = -1 Query: 410 MPRKKQQRRFRIPWISGPSTGSQSRPKQRSKSASQLDTNTPIQRPPFR 267 MPRK QQ FRIPWI+GPST S S PKQ+SKS S +RPPFR Sbjct: 1 MPRKNQQCGFRIPWITGPSTESHSSPKQKSKSLS-------TRRPPFR 41 >gb|KOM51592.1| hypothetical protein LR48_Vigan09g025100 [Vigna angularis] Length = 349 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = -1 Query: 410 MPRKKQQRRFRIPWISGPSTGSQSRPKQRSKSASQLDTNTPIQRPPFR 267 MPRK QQ FRIPWI+GPST S S PKQ+SKS S +RPPFR Sbjct: 1 MPRKNQQCGFRIPWITGPSTESHSPPKQKSKSLS-------TRRPPFR 41