BLASTX nr result
ID: Wisteria21_contig00039779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00039779 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006588959.1| PREDICTED: protein IQ-DOMAIN 14-like isoform... 72 1e-10 >ref|XP_006588959.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Glycine max] gi|571482472|ref|XP_006588960.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Glycine max] gi|734424792|gb|KHN42797.1| Protein IQ-DOMAIN 14 [Glycine soja] gi|947084476|gb|KRH33197.1| hypothetical protein GLYMA_10G106000 [Glycine max] Length = 390 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 271 PRQRTGFLDICSDQNEPHKEGISSCFSYYHGASTSTNENSDCYQQRC 131 P+QRTG LDICS+QNEPHKEGI SYY GA++STNENS YQQRC Sbjct: 345 PKQRTGILDICSNQNEPHKEGIFFGSSYY-GATSSTNENSASYQQRC 390