BLASTX nr result
ID: Wisteria21_contig00039603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00039603 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608504.2| transmembrane protein, putative [Medicago tr... 58 2e-06 >ref|XP_003608504.2| transmembrane protein, putative [Medicago truncatula] gi|657389734|gb|AES90701.2| transmembrane protein, putative [Medicago truncatula] Length = 314 Score = 58.2 bits (139), Expect = 2e-06 Identities = 37/86 (43%), Positives = 49/86 (56%), Gaps = 6/86 (6%) Frame = -1 Query: 246 SDNKILRRVTGVSLVLACILGLFNFSSKMSPKFNTAYAFPAISGGEG--ALGSLLQMSNS 73 S+NK LR ++GVSLVL CILG+ NFS M+PK + A F + G G SL N+ Sbjct: 83 SENKNLRGMSGVSLVLGCILGIINFSGMMNPKISMALPFDPTNIGRGVNTFDSLWNTINA 142 Query: 72 EPAEHS----GNKAPVDAVKVHAIRL 7 E E + N+ VD K+HA+ L Sbjct: 143 EGVELNPKLDPNETLVDKKKMHALYL 168