BLASTX nr result
ID: Wisteria21_contig00039547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00039547 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 82 2e-13 prf||1211235CE ORF 79 79 1e-12 ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabac... 79 1e-12 gb|KQJ96841.1| hypothetical protein BRADI_3g27343, partial [Brac... 66 9e-09 gb|KQJ88603.1| hypothetical protein BRADI_4g19726, partial [Brac... 65 3e-08 gb|KQJ95761.1| hypothetical protein BRADI_3g18879, partial [Brac... 64 4e-08 ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia olerac... 58 3e-06 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -3 Query: 317 TIFIDRSCHIGPSRTSN*FNLNYPEDTLYIFSQKNG*SNLFLDSIEAQRGE 165 +I IDRSCHIGPS+TSN F+LNYPED L I QKNG SNLFLDSIEA+RGE Sbjct: 11 SISIDRSCHIGPSQTSNCFDLNYPEDALSILYQKNGQSNLFLDSIEAKRGE 61 >prf||1211235CE ORF 79 Length = 79 Score = 79.0 bits (193), Expect = 1e-12 Identities = 45/72 (62%), Positives = 53/72 (73%) Frame = -3 Query: 308 IDRSCHIGPSRTSN*FNLNYPEDTLYIFSQKNG*SNLFLDSIEAQRGE*DPK**EICKKQ 129 IDRSCHIGPS TSN F+LNYPE+ + QK+G SNLFLDS++ E + EICKKQ Sbjct: 12 IDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLDSLK----EVNRVPIEICKKQ 67 Query: 128 VPLRLFLILNEM 93 V LR+FLILN M Sbjct: 68 VRLRVFLILNGM 79 >ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabacum] gi|11466029|ref|NP_054571.1| hypothetical protein NitaCp098 [Nicotiana tabacum] gi|78102586|ref|YP_358726.1| hypothetical protein NisyCp082 [Nicotiana sylvestris] gi|78102613|ref|YP_358752.1| hypothetical protein NisyCp111 [Nicotiana sylvestris] gi|81301616|ref|YP_398912.1| hypothetical protein NitoCp081 [Nicotiana tomentosiformis] gi|81301643|ref|YP_398938.1| hypothetical protein NitoCp109 [Nicotiana tomentosiformis] gi|351653909|ref|YP_004891655.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653954|ref|YP_004891681.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|4388760|emb|CAA77389.1| hypothetical protein [Nicotiana tabacum] gi|4388762|emb|CAA77404.1| hypothetical protein [Nicotiana tabacum] gi|77799613|dbj|BAE46702.1| hypothetical protein [Nicotiana sylvestris] gi|77799640|dbj|BAE46729.1| hypothetical protein [Nicotiana sylvestris] gi|80750975|dbj|BAE48051.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751002|dbj|BAE48078.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453935|gb|AEO95593.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453980|gb|AEO95638.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454046|gb|AEO95703.1| hypothetical protein [synthetic construct] gi|347454089|gb|AEO95746.1| hypothetical protein [synthetic construct] Length = 79 Score = 79.0 bits (193), Expect = 1e-12 Identities = 45/72 (62%), Positives = 53/72 (73%) Frame = -3 Query: 308 IDRSCHIGPSRTSN*FNLNYPEDTLYIFSQKNG*SNLFLDSIEAQRGE*DPK**EICKKQ 129 IDRSCHIGPS TSN F+LNYPE+ + QK+G SNLFLDS++ E + EICKKQ Sbjct: 12 IDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLDSLK----EVNRVPIEICKKQ 67 Query: 128 VPLRLFLILNEM 93 V LR+FLILN M Sbjct: 68 VRLRVFLILNGM 79 >gb|KQJ96841.1| hypothetical protein BRADI_3g27343, partial [Brachypodium distachyon] gi|944082856|gb|KQK18208.1| hypothetical protein BRADI_1g05797, partial [Brachypodium distachyon] Length = 98 Score = 66.2 bits (160), Expect = 9e-09 Identities = 47/89 (52%), Positives = 52/89 (58%), Gaps = 4/89 (4%) Frame = +2 Query: 41 VIRAYLNRYSVYI*IP--APFHLGLGIGVMGPAFYISLIIL--DPIHLFGLLLNREIGLI 208 VIRAY NR P F+LGLGIGV PAF IS++ L +HLFGLLLNREIGL Sbjct: 1 VIRAYGNRILCLHRNPYVLTFYLGLGIGVSRPAFDISILFLFGYHMHLFGLLLNREIGLC 60 Query: 209 IHFFERIYIRYPLDNSN*INWMSDSGLYD 295 P DN+N MSDSGLYD Sbjct: 61 -----------PTDNANRSYLMSDSGLYD 78 >gb|KQJ88603.1| hypothetical protein BRADI_4g19726, partial [Brachypodium distachyon] Length = 98 Score = 64.7 bits (156), Expect = 3e-08 Identities = 46/88 (52%), Positives = 51/88 (57%), Gaps = 4/88 (4%) Frame = +2 Query: 44 IRAYLNRYSVYI*IP--APFHLGLGIGVMGPAFYISLIIL--DPIHLFGLLLNREIGLII 211 IRAY NR P F+LGLGIGV PAF IS++ L +HLFGLLLNREIGL Sbjct: 2 IRAYGNRILYLHRNPYVLTFYLGLGIGVSRPAFDISILFLFGYHMHLFGLLLNREIGLC- 60 Query: 212 HFFERIYIRYPLDNSN*INWMSDSGLYD 295 P DN+N MSDSGLYD Sbjct: 61 ----------PTDNANRSYLMSDSGLYD 78 >gb|KQJ95761.1| hypothetical protein BRADI_3g18879, partial [Brachypodium distachyon] Length = 98 Score = 63.9 bits (154), Expect = 4e-08 Identities = 46/88 (52%), Positives = 51/88 (57%), Gaps = 4/88 (4%) Frame = +2 Query: 41 VIRAYLNRYSVYI*IP--APFHLGLGIGVMGPAFYISLIIL--DPIHLFGLLLNREIGLI 208 VIRAY NR P F+LGLGIGV PAF IS++ L +HLFGLLLNREIGL Sbjct: 1 VIRAYGNRILCLHRNPYVLTFYLGLGIGVSRPAFDISILFLFGYHMHLFGLLLNREIGLC 60 Query: 209 IHFFERIYIRYPLDNSN*INWMSDSGLY 292 P DN+N MSDSGLY Sbjct: 61 -----------PTDNANRSYLMSDSGLY 77 >ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia oleracea] gi|11497597|ref|NP_055003.1| hypothetical protein SpolCp101 [Spinacia oleracea] gi|7636149|emb|CAB88771.1| hypothetical protein (chloroplast) [Spinacia oleracea] gi|7636178|emb|CAB88800.1| hypothetical protein (chloroplast) [Spinacia oleracea] Length = 57 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -2 Query: 294 SYRPESDIQLIQFELSRGYLIYILSKKWIIKPISRFNRSPKR 169 SYRP SDIQL++F LS GYLIYI SK+W IK + RFNRS KR Sbjct: 17 SYRPGSDIQLLRFALSGGYLIYI-SKRWTIKLLFRFNRSLKR 57